Recombinant Full Length Danio Rerio Solute Carrier Family 25 Member 39(Slc25A39) Protein, His-Tagged
Cat.No. : | RFL19037DF |
Product Overview : | Recombinant Full Length Danio rerio Solute carrier family 25 member 39(slc25a39) Protein (Q7SXW0) (1-359aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-359) |
Form : | Lyophilized powder |
AA Sequence : | MGDRPAVRISAAITPVQQMLASGTGAVLTSLFVTPLDVVKIRLQAQQTPLFQAIAAESRP WFRVTRPSKWKCFLYCNGLMDHVYVCQNMSSCSNLYKTSTHFSGTLDAFVKITHNEGLRS LWSGLPPTLVMAVPATVIYFTCYDQLRDFLCYSMGYHGDHIPLIAGGLARLGAVSVISPL ELVRTKMQSRRLQYSELMVCIRSSVAQDGWLSLWRGWGPTVLRDVPFSALYWFNYELVKA QLCEHYRTPQASFTISFTAGAVSGAIAAVLTLPFDVVKTRRQIQLGEMEALGAVSMKKPS STWNMMRNIWIDMGYKGLFAGFLPRVIKVAPACAVMISTYEFGKTFFQERNLHQARCGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | slc25a39 |
Synonyms | slc25a39; zgc:63736; Solute carrier family 25 member 39 |
UniProt ID | Q7SXW0 |
◆ Recombinant Proteins | ||
SLC25A39-5478R | Recombinant Rat SLC25A39 Protein | +Inquiry |
SLC25A39-4255R | Recombinant Rhesus monkey SLC25A39 Protein, His-tagged | +Inquiry |
RFL17954BF | Recombinant Full Length Bovine Solute Carrier Family 25 Member 39(Slc25A39) Protein, His-Tagged | +Inquiry |
Slc25a39-2067M | Recombinant Mouse Slc25a39 Protein, His-tagged | +Inquiry |
RFL31173MF | Recombinant Full Length Mouse Solute Carrier Family 25 Member 39(Slc25A39) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A39-1763HCL | Recombinant Human SLC25A39 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All slc25a39 Products
Required fields are marked with *
My Review for All slc25a39 Products
Required fields are marked with *
0
Inquiry Basket