Recombinant Full Length Danio Rerio Rhodopsin(Rho) Protein, His-Tagged
Cat.No. : | RFL27028DF |
Product Overview : | Recombinant Full Length Danio rerio Rhodopsin(rho) Protein (P35359) (1-354aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-354) |
Form : | Lyophilized powder |
AA Sequence : | MNGTEGPAFYVPMSNATGVVRSPYEYPQYYLVAPWAYGLLAAYMFFLIITGFPVNFLTLY VTIEHKKLRTPLNYILLNLAIADLFMVFGGFTTTMYTSLHGYFVFGRLGCNLEGFFATLG GEMGLWSLVVLAIERWMVVCKPVSNFRFGENHAIMGVAFTWVMACSCAVPPLVGWSRYIP EGMQCSCGVDYYTRTPGVNNESFVIYMFIVHFFIPLIVIFFCYGRLVCTVKEAAAQQQES ETTQRAEREVTRMVIIMVIAFLICWLPYAGVAWYIFTHQGSEFGPVFMTLPAFFAKTSAV YNPCIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTASKTEASSVSSSSVSPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rho |
Synonyms | rho; zfo2; Rhodopsin |
UniProt ID | P35359 |
◆ Recombinant Proteins | ||
DACT2-4867Z | Recombinant Zebrafish DACT2 | +Inquiry |
SCNN1A-6242H | Recombinant Human SCNN1A Protein (Tyr112-Thr543), N-His tagged | +Inquiry |
TNFRSF4-115R | Recombinant Rabbit TNFRSF4 protein, Fc-tagged | +Inquiry |
LECT1-6748Z | Recombinant Zebrafish LECT1 | +Inquiry |
LIM2-3065R | Recombinant Rat LIM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
SV40gp6-268 | Active Native Simian virus 40 SV40gp6 protein | +Inquiry |
C4A-8392H | Native Human C4A | +Inquiry |
SERPINC1-26143TH | Native Human SERPINC1 | +Inquiry |
T.gondii-39 | Native Toxoplasma gondii Antigen | +Inquiry |
Tnnt3-7424M | Native Mouse Tnnt3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGFBP3-421HCL | Recombinant Human FGFBP3 cell lysate | +Inquiry |
FUT1-6117HCL | Recombinant Human FUT1 293 Cell Lysate | +Inquiry |
MMP10-4282HCL | Recombinant Human MMP10 293 Cell Lysate | +Inquiry |
PPP1R3B-2935HCL | Recombinant Human PPP1R3B 293 Cell Lysate | +Inquiry |
ATAD1-44HCL | Recombinant Human ATAD1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All rho Products
Required fields are marked with *
My Review for All rho Products
Required fields are marked with *
0
Inquiry Basket