Recombinant Full Length Danio Rerio Protein Yif1B(Yif1B) Protein, His-Tagged
Cat.No. : | RFL1415DF |
Product Overview : | Recombinant Full Length Danio rerio Protein YIF1B(yif1b) Protein (Q5U3G6) (1-304aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-304) |
Form : | Lyophilized powder |
AA Sequence : | MMEYPNQSGFRQRKLLPQVRMRGSAMEPSDPTQLFDDTSSGVNKHEPGRVGKSPDVFSGQ NLLSDPMSNLAMAYGSSLASHGKEMMDKNLDRFIPISKLKYYFAVDTVYVGKKLGLLVFP YMHDNWEVNYQQDTPVAPRFDINAPDLYIPVMGFITYVLVAGLALGTQNRFSPEILGIQA SSALVWLIIEVLAVLLSLYLVTVNTDLTTIDLVAFSGYKYVGMIVGVVAGLLFGRTGYYL ALLWFCASIFVFTIRTLRLKILSEAAAEGRLVRGTKNQLRMYLTMAIAAAQPVFMYWLTF HLVR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yif1b |
Synonyms | yif1b; zgc:103562; Protein YIF1B; YIP1-interacting factor homolog B |
UniProt ID | Q5U3G6 |
◆ Recombinant Proteins | ||
ZYG11B-19262M | Recombinant Mouse ZYG11B Protein | +Inquiry |
UBE1-3525H | Recombinant Human UBE1 protein, His-tagged | +Inquiry |
BCAR1-5042H | Recombinant Human BCAR1, His-tagged | +Inquiry |
HEXB-7594M | Recombinant Mouse HEXB Protein | +Inquiry |
ABCB7-192M | Recombinant Mouse ABCB7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1783G | Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, DyLight 594 Labeled | +Inquiry |
Calmodulin-016 | Native Calmodulin Protein | +Inquiry |
CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
LOC100514666-45P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
FGG -44D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNK1-223HCL | Recombinant Human KCNK1 Lysate | +Inquiry |
ASNSD1-8648HCL | Recombinant Human ASNSD1 293 Cell Lysate | +Inquiry |
BBX-159HCL | Recombinant Human BBX cell lysate | +Inquiry |
PCBD1-3405HCL | Recombinant Human PCBD1 293 Cell Lysate | +Inquiry |
ACCS-9098HCL | Recombinant Human ACCS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yif1b Products
Required fields are marked with *
My Review for All yif1b Products
Required fields are marked with *
0
Inquiry Basket