Recombinant Full Length Danio Rerio Phosphatidylinositide Phosphatase Sac1-B(Sacm1Lb) Protein, His-Tagged
Cat.No. : | RFL20288DF |
Product Overview : | Recombinant Full Length Danio rerio Phosphatidylinositide phosphatase SAC1-B(sacm1lb) Protein (A4VCH0) (1-586aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-586) |
Form : | Lyophilized powder |
AA Sequence : | MANAYERFNLHSTPEKFYIEACDDGADDVLVIDRVSTEMTLAGIKDIPPSGITRPICGVM GTVRLVAGMYLIVITRKRKVGDLFGHTVWKAVEFDVISYKKTILHLTDIQMQDNKTFLTM INNVLNTDGFYFCTDYDLTHTQQRLSNTSPDFQEMSLLERADQRFMWNGNLLREIIAQPE LHKFAFPVIHGFIVMKPCCINGKVFEWIIISRRSCFRAGVRYYVRGIDSEGHAANFVETE QIVQFNNARASFVQTRGSIPFFWSQRPNLKYKPKPLISKDTNHMDGLRRHFESQVLIYGK QVILNLVNQKGSELPLEQAFAKMVSSMENGFIKYIAFDFHKECSKMRWHRLQILVDAVSD MQEEFGYFMVSSDGKVLSEQSGTFRSNCMDCLDRTNVIQSLLARRSLQSQLQRMGVLHVG QKIEEQADFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTHWGLVMDGWNSMIRY YKNNFSDGFRQDSIDLFLGNYSVDETDSLTPLHVKKDWKFLLLPVIMVVAFSMCIICLLM AGDTWTETLAYVLFWGMASALTAAVIVVNGREFVDAPKLVQKEKMD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sacm1la |
Synonyms | sacm1la; si:ch211-222e23.8; Phosphatidylinositol-3-phosphatase SAC1-A; Phosphatidylinositol-4-phosphate phosphatase; Suppressor of actin mutations 1-like protein A |
UniProt ID | A4VCH0 |
◆ Recombinant Proteins | ||
CD33-0704H | Recombinant Human CD33 protein, His-tagged, APC-Labeled | +Inquiry |
FGF2-044H | Active Recombinant Human FGF2 Protein | +Inquiry |
SCO6583-1003S | Recombinant Streptomyces coelicolor A3(2) SCO6583 protein, His-tagged | +Inquiry |
MAGI1-3541R | Recombinant Rat MAGI1 Protein | +Inquiry |
RPLP2-5550H | Recombinant Human Ribosomal Protein, Large, P2, His-tagged | +Inquiry |
◆ Native Proteins | ||
WIM-5415B | Native Bovine Vimentin | +Inquiry |
FGA-6H | Native Human Fibrinogen Protein, Alexa Fluor 488 labeled | +Inquiry |
IgG-218D | Native Dog Immunoglobulin G | +Inquiry |
GAPDH-126R | Active Native Rabbit GAPDH | +Inquiry |
gGT-184B | Active Native Bovine Gamma-Glutamyl Transferase | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNA1-5079HCL | Recombinant Human KCNA1 293 Cell Lysate | +Inquiry |
AMPK-416HCL | Recombinant Human AMPK cell lysate | +Inquiry |
CENPA-7586HCL | Recombinant Human CENPA 293 Cell Lysate | +Inquiry |
MAGOH-1047HCL | Recombinant Human MAGOH cell lysate | +Inquiry |
PRPF38A-503HCL | Recombinant Human PRPF38A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sacm1la Products
Required fields are marked with *
My Review for All sacm1la Products
Required fields are marked with *
0
Inquiry Basket