Recombinant Full Length Danio Rerio Calcium-Binding Mitochondrial Carrier Protein Scamc-2-B(Slc25A25B) Protein, His-Tagged
Cat.No. : | RFL4951DF |
Product Overview : | Recombinant Full Length Danio rerio Calcium-binding mitochondrial carrier protein SCaMC-2-B(slc25a25b) Protein (A2CEQ0) (1-469aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-469) |
Form : | Lyophilized powder |
AA Sequence : | MLCLCLYVPVHISERTEFEYFESESLPVQLKSLFKLSLFLPSQEFDSYRKWRKKVVKAGD KDLDGQLDFEEFVHYLRDHEKKLRLVFKSLDKKNDGHIDSQEIMQSLRDLGVHISEEQAE KILKSMDKNGTMTIDWNEWRDYHLLHPAENIPEIILYWKHSTIFDVGESMLVPDEFTAEE KNTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHATRSNSMGIAGGFTQMIREGGLR SLWRGNGINVLKIAPESAIKFMAYEQIKRLIGSNQETLGILERLVSGSLAGAIAQSSIYP MEVLKTRLALGRTGQYSGIADCAKHIFKKEGMTAFYKGYIPNMLGIIPYAGIDLAVYETL KNSWLQRFATDSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQASQEGSPQMTMS GLFRHIVRTEGAIGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | slc25a25b |
Synonyms | slc25a25b; scamc2b; si:dkey-7o20.1; Calcium-binding mitochondrial carrier protein SCaMC-2-B; Small calcium-binding mitochondrial carrier protein 2-B; Solute carrier family 25 member 25-B |
UniProt ID | A2CEQ0 |
◆ Recombinant Proteins | ||
Pfdn6-1086M | Recombinant Mouse Pfdn6 Protein, MYC/DDK-tagged | +Inquiry |
PSMC3IP-153H | Recombinant Human PSMC3IP protein, T7/His-tagged | +Inquiry |
YOPX-3699B | Recombinant Bacillus subtilis YOPX protein, His-tagged | +Inquiry |
TNFSF11-2025R | Recombinant Rat TNFSF11 Protein | +Inquiry |
MRPL18-2837R | Recombinant Rhesus monkey MRPL18 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Crp-5382R | Native Rat C-Reactive Protein, Petaxin Related | +Inquiry |
ELANE-3221H | Active Native Human ELANE Protein | +Inquiry |
Col1a1-7174M | Native Mouse Col1a1 Protein | +Inquiry |
COL2A1-14B | Native Bovine COL2A1 Protein | +Inquiry |
IgA-251G | Native Goat Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDH5A1-60HCL | Recombinant Human ALDH5A1 cell lysate | +Inquiry |
ERBB2-2658HCL | Recombinant Human ERBB2 cell lysate | +Inquiry |
Pancreas-648B | Bovine Pancreas Lysate, Total Protein | +Inquiry |
GINS4-5931HCL | Recombinant Human GINS4 293 Cell Lysate | +Inquiry |
DUSP22-6777HCL | Recombinant Human DUSP22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All slc25a25b Products
Required fields are marked with *
My Review for All slc25a25b Products
Required fields are marked with *
0
Inquiry Basket