Recombinant Full Length Cytochrome C Biogenesis Protein Ccs1(Ccs1) Protein, His-Tagged
Cat.No. : | RFL8994EF |
Product Overview : | Recombinant Full Length Cytochrome c biogenesis protein ccs1(ccs1) Protein (Q4G3C0) (1-440aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Emiliania huxleyi (Pontosphaera huxleyi) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-440) |
Form : | Lyophilized powder |
AA Sequence : | MVFSTKLYTTKLLKKLADLRLAIWLLASIGILIALGTFIEQDQPLAFYQENYPTTAPILG FVDWKFITSLNLNTLYSNIWFFGIVGFFASSLLACTYTTQIPALKKFRLWEFITNFKSLR KFQLKRQLPRNLASTSVYQLYGKNYHVFRQGKKNYAYSGLLGRVGPILVHFSILFVLFGS ACGALGGYTVQEIVPRGEIFHLQNLVKSGNLSKIPQYLSWRVNDFWITYTEEAKVNQFYS DLSILDVKGQEVKRKIIFVNEPLVYNGVSVYQTDWDILGLKLKLNDQQTIQVPLNKISKS GRNFWLGSVFLDGNSKQKITILLNDLTGNIYVYDNAGLLVATTKLGQLVVFPEDQSLRFQ EFLTTTGLQLKEDPGLRLIYLSFFLVMVSIYISFLSYSQIWGFEKTDEFILAGKSNRAVL AFQEDFKKDVKEILNTLKFN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccs1 |
Synonyms | ccs1; Cytochrome c biogenesis protein Ccs1 |
UniProt ID | Q4G3C0 |
◆ Recombinant Proteins | ||
MRPL50-6440HF | Recombinant Full Length Human MRPL50 Protein, GST-tagged | +Inquiry |
SAP019A-003-2229S | Recombinant Staphylococcus aureus (strain: NRS104) SAP019A_003 protein, His-tagged | +Inquiry |
MYO18A-5855M | Recombinant Mouse MYO18A Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB6A-3758R | Recombinant Rhesus monkey RAB6A Protein, His-tagged | +Inquiry |
HYAL3-7954M | Recombinant Mouse HYAL3 Protein | +Inquiry |
◆ Native Proteins | ||
IgG-217H | Native Human Immunoglobulin G (IgG) | +Inquiry |
Plasminogen-87H | Native Human Plasminogen | +Inquiry |
MMP9-30035TH | Native Human MMP9 | +Inquiry |
S100A14-394H | Native Human S100A14 protein(Gly2-His104), His-tagged | +Inquiry |
Lectin-1787G | Active Native Griffonia Simplicifolia Lectin II Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
APCDD1-001HCL | Recombinant Human APCDD1 cell lysate | +Inquiry |
PRKAR2A-2861HCL | Recombinant Human PRKAR2A 293 Cell Lysate | +Inquiry |
STX5-1374HCL | Recombinant Human STX5 293 Cell Lysate | +Inquiry |
KLRB1A-1745MCL | Recombinant Mouse KLRB1A cell lysate | +Inquiry |
KLF13-4931HCL | Recombinant Human KLF13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccs1 Products
Required fields are marked with *
My Review for All ccs1 Products
Required fields are marked with *
0
Inquiry Basket