Recombinant Full Length Cytochrome C Biogenesis Protein Ccs1(Ccs1) Protein, His-Tagged
Cat.No. : | RFL12968PF |
Product Overview : | Recombinant Full Length Cytochrome c biogenesis protein ccs1(ccs1) Protein (Q1XDC4) (1-440aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pyropia yezoensis (Susabi-nori) (Porphyra yezoensis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-440) |
Form : | Lyophilized powder |
AA Sequence : | MKRQLNLRFNRKDIRWYLLRLFSNLQFSIILLLLIAIFSTIGTVIEQNKESSFYQTQYTL SNEYYNILNWKNIELFGFNHVYTTWWFLSLLFIFSLSLFTCSISRQIPSLQNARRWHFYK NPNQFKKFTGSQEIKTTQLNLLASCLQNYNYHIFQQGKSIYGYKGLLGRLAPIFVHGSII LLLTGSVLGLVSGFSAQEMVPSGELFRLQNIISSGKFSYIPQEFSARVNDFNIEYNPNKS ISQFFSDISILNSEGKELKRSTIYVNKPLEFHGLTIYQTDWDIIAIRVRINNGNILQIPL KSVLLPNNNKIWIGVLFQEKESQLSVVLSDLQGQATIYNKNGKNILSINIGEKYIINNST ITFLNTIASTGLQIKNDPGIPIVYASFFFLITSISVSYISYSQIWIVEKNRHFYIGGVTN RAQLMFEEELLKISKMSSSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccs1 |
Synonyms | ccs1; ycf44; Cytochrome c biogenesis protein Ccs1 |
UniProt ID | Q1XDC4 |
◆ Recombinant Proteins | ||
YUZD-2736B | Recombinant Bacillus subtilis YUZD protein, His-tagged | +Inquiry |
SGR-RS30035-893S | Recombinant Streptomyces griseus subsp. griseus NBRC 13350 SGR_RS30035 protein, His-tagged | +Inquiry |
LOXL2-4731H | Recombinant Human LOXL2 Protein, GST-tagged | +Inquiry |
XPNPEP2-6574H | Recombinant Human XPNPEP2 Protein | +Inquiry |
HAVCR2-213CAF488 | Recombinant Monkey HAVCR2 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Native Proteins | ||
GPT-1840H | Active Native Human GPT | +Inquiry |
AHSG-111H | Native Human Alpha 2 HS Glycoprotein | +Inquiry |
AGT-152H | Native Human Angiotensinogen | +Inquiry |
B. garinii-22 | Native Borrelia garinii Antigen | +Inquiry |
SERPINA1-27286TH | Native Human SERPINA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
YWHAG-232HCL | Recombinant Human YWHAG 293 Cell Lysate | +Inquiry |
ARL6-8708HCL | Recombinant Human ARL6 293 Cell Lysate | +Inquiry |
MRPL43-4164HCL | Recombinant Human MRPL43 293 Cell Lysate | +Inquiry |
Muscles-863R | Mini Rabbit S. Muscles Membrane Lysate, Total Protein | +Inquiry |
TNFAIP8L1-696HCL | Recombinant Human TNFAIP8L1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccs1 Products
Required fields are marked with *
My Review for All ccs1 Products
Required fields are marked with *
0
Inquiry Basket