Recombinant Full Length Cytochrome Bc Complex Cytochrome B Subunit(Petb) Protein, His-Tagged
Cat.No. : | RFL15340CF |
Product Overview : | Recombinant Full Length Cytochrome bc complex cytochrome b subunit(petB) Protein (Q59297) (2-428aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlorobaculum thiosulfatiphilum (Chlorobium limicola f.sp. thiosulfatophilum) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-428) |
Form : | Lyophilized powder |
AA Sequence : | AENTPKPAAGTAPAKPKPAAPGAAKPAAPKAARPGAAKPAAKPAAPRAAAPSGVYKKPPV DRPDPNPFKDSKRDAVAGWFQERFYVLNPIIDYLKHKEVPKHALSFWYYFGGLGLFFFVI QILTGLLLLQYYKPTETDAFASFLFIQGEVPFGWLLRQIHAWSANLMIMMLFIHMFSTFF MKSYRKPRELMWVSGFVLLLLSLGFGFTGYLLPWNELAFFATQVGTEVPKVAPGGAFLVE ILRGGPEVGGETLTRMFSLHVVLLPGLVMLVLAAHLTLVQILGTSAPIGYKEAGLIKGYD KFFPTFLAKDGIGWLIGFALLIYLAVMFPWEIGVKANPLSPAPLGIKPEWYFWAQFQLLK DFKFEGGELLAIILFTIGGVVWLLVPFIDRQASEEKKSPIFTIFGILVLAFLLINTYRVY AEYSMLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | petB |
Synonyms | petB; Cytochrome bc complex cytochrome b subunit |
UniProt ID | Q59297 |
◆ Recombinant Proteins | ||
gp41-08H | Recombinant HIV-1 gp41 Antigen, Tag Free | +Inquiry |
ZP3A.1-2078Z | Recombinant Zebrafish ZP3A.1 | +Inquiry |
BARX1-1818HF | Recombinant Full Length Human BARX1 Protein, GST-tagged | +Inquiry |
CLPX-1122R | Recombinant Rat CLPX Protein, His (Fc)-Avi-tagged | +Inquiry |
Tnfrsf4-7400MF | Recombinant Mouse Tnfrsf4 Protein, hFc-tagged, FITC conjugated | +Inquiry |
◆ Native Proteins | ||
Trf-70M | Native Mouse Apotransferrin | +Inquiry |
IGHA2-615H | Native Human Immunoglobulin Heavy Constant Alpha 2 (A2m marker) | +Inquiry |
Lectin-1847S | Active Native Soybean Agglutinin Protein, Fluorescein labeled | +Inquiry |
IgA-241F | Native Ferret Immunoglobulin A | +Inquiry |
CMA1-35H | Active Native Human CMA1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C14orf142-8287HCL | Recombinant Human C14orf142 293 Cell Lysate | +Inquiry |
NPFFR2-1209HCL | Recombinant Human NPFFR2 cell lysate | +Inquiry |
C11orf65-76HCL | Recombinant Human C11orf65 lysate | +Inquiry |
FAM24B-6385HCL | Recombinant Human FAM24B 293 Cell Lysate | +Inquiry |
CFHR1-1289HCL | Recombinant Human CFHR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All petB Products
Required fields are marked with *
My Review for All petB Products
Required fields are marked with *
0
Inquiry Basket