Recombinant Full Length Cytochrome B6(Petb) Protein, His-Tagged
Cat.No. : | RFL10887CF |
Product Overview : | Recombinant Full Length Cytochrome b6(petB) Protein (Q71KQ6) (1-215aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Coleochaete orbicularis (Charophycean green alga) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-215) |
Form : | Lyophilized powder |
AA Sequence : | MGKVYDWFEERLEIQAIADDISSKYVPPHVNIFYCLGGITFTCFLLQVASGFAMTFYYRP TVAEAFASVQYIMTDVNFGWLIRSVHRWSASMMVLTMILHVFRVYLTGGFKKPRELTWVT GVILAVLTVSFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGSPLVELLRGSVSVGQSTL TRFYSLHTFILPLLTAVFMLMHFLMIRKQGISGPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | petB |
Synonyms | petB; Cytochrome b6 |
UniProt ID | Q71KQ6 |
◆ Recombinant Proteins | ||
PXDN-3893H | Recombinant Human PXDN protein, His-tagged | +Inquiry |
C17orf75-5882H | Recombinant Human C17orf75 Protein, GST-tagged | +Inquiry |
PNMT-197H | Active Recombinant Human PNMT protein, GST-tagged | +Inquiry |
CHRNA9-1053R | Recombinant Rat CHRNA9 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALB-323D | Recombinant Dog ALB Protein (25-608 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
HPX-207H | Native Human Hemopexin | +Inquiry |
IgG-004B | Native Bovine Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Lectin-1829P | Active Native Pisum Sativum Agglutinin Protein | +Inquiry |
MMP2-47H | Native Human MMP-2/TIMP-2 Complex | +Inquiry |
OX-LDL-985H | Native Human Lipoproteins, Oxidized LDL protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EVI2A-001HCL | Recombinant Human EVI2A cell lysate | +Inquiry |
WNT7B-288HCL | Recombinant Human WNT7B 293 Cell Lysate | +Inquiry |
AK9-125HCL | Recombinant Human AK9 lysate | +Inquiry |
TRH-801HCL | Recombinant Human TRH 293 Cell Lysate | +Inquiry |
DHX15-6933HCL | Recombinant Human DHX15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All petB Products
Required fields are marked with *
My Review for All petB Products
Required fields are marked with *
0
Inquiry Basket