Recombinant Full Length Cycas Taitungensis Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL23062CF |
Product Overview : | Recombinant Full Length Cycas taitungensis Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (A6H5G7) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cycas taitungensis (Prince sago) (Cycas taiwaniana) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTLALAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGPGGEVVDTFPYFVSGVLHLISSAVLGFGGIYHAL IGPETLEESLPFFGYVWKDRSKMTTILGIHLILLGVGAFLLVLKALYFGGVYDTWAPGGG DVRKITNLTLSPSVIFGYLLESPFGGEGWIVSVDNLEDIIGGHVWLGSICIFGGIWHILT KPFAWARRAFVWSGEAYLSYSLGALSVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDLRAPWLEPLRGPNG LDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLG FFFFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMNPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | A6H5G7 |
◆ Recombinant Proteins | ||
IL6R-200H | Active Recombinant Human IL6R, MIgG2a Fc-tagged | +Inquiry |
TNFRSF9A-3790Z | Recombinant Zebrafish TNFRSF9A | +Inquiry |
IFI30-4429M | Recombinant Mouse IFI30 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ccl8-021C | Active Recombinant Mouse Ccl8 Protein (74 aa) | +Inquiry |
MFSD11-435C | Recombinant Cynomolgus Monkey MFSD11 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CEase-21P | Active Native Porcine Cholesterol esterase | +Inquiry |
GCKR-8324S | Native S. cerevisiae GCKR | +Inquiry |
AHSG-1001H | Human Leucine-rich Alpha-2-glycoprotein 1 | +Inquiry |
PLC-30 | Active Native Phospholipase C | +Inquiry |
Collagen Type IV-09H | Native Human Collagen Type IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
THOC1-1095HCL | Recombinant Human THOC1 293 Cell Lysate | +Inquiry |
Heart-198H | Human Heart (Congenital heart disease) Lysate | +Inquiry |
FAM109B-254HCL | Recombinant Human FAM109B lysate | +Inquiry |
SPATA19-624HCL | Recombinant Human SPATA19 lysate | +Inquiry |
SNAPC2-1653HCL | Recombinant Human SNAPC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket