Recombinant Full Length Cyberlindnera Jadinii Squalene Synthase(Erg9) Protein, His-Tagged
Cat.No. : | RFL36655CF |
Product Overview : | Recombinant Full Length Cyberlindnera jadinii Squalene synthase(ERG9) Protein (O74165) (1-443aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cyberlindnera jadinii (Torula yeast) (Pichia jadinii) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-443) |
Form : | Lyophilized powder |
AA Sequence : | MGKLLQLALHPDELASIVQFKLFRKNENARNPATESAELIRCYELLNLTSRSFAAVIEEL HPELRNVIMVFYLVLRALDTVEVDMSIENSVKLPVLRQFHEKLDTKDWTFDGNSPNEKDR CVLVEFDRILGQYHELKPQYQKVIKEITEKMGNGMADYIENENFNSNGLLTIEDYDLYCY YVAGLVGDGLTQLIVLAKFGNSELSVNKQLFKSMGLFLQKTNIIRDYEEDQVDGRAFWPK EIWGKYANELSDFMKPENQSQGLWCISELVCNALDHVIDVLQYLALVEEQTSFNFCAIPQ VMAIATLELVFQNPQVLTQHVKIRKGTTVSLILESRTLEGCARIFRRYLRKIHHKSHPSD PNYLRLGITIGKIEQFLDGMYPHYVPKGITPQTTSIRTQVVKRLQLDEPMKRDIDEEILK TRILLLSLGVAVFGVVYGVVRII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERG9 |
Synonyms | ERG9; Squalene synthase; SQS; SS; FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase |
UniProt ID | O74165 |
◆ Native Proteins | ||
CKMM-166M | Native Mouse Creatine Kinase MM | +Inquiry |
TNNI3-221H | Native Human TNNI3 | +Inquiry |
R-PE-004R | Native Red Fluorescent Protein | +Inquiry |
CVB1-12 | Native Coxsackievirus B1 Antigen | +Inquiry |
Lectin-1865W | Active Native Succinylated Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
UQCRC1-488HCL | Recombinant Human UQCRC1 293 Cell Lysate | +Inquiry |
CD74-2603HCL | Recombinant Human CD74 cell lysate | +Inquiry |
SLC39A4-1719HCL | Recombinant Human SLC39A4 293 Cell Lysate | +Inquiry |
TRIM25-788HCL | Recombinant Human TRIM25 293 Cell Lysate | +Inquiry |
FNTB-6170HCL | Recombinant Human FNTB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERG9 Products
Required fields are marked with *
My Review for All ERG9 Products
Required fields are marked with *
0
Inquiry Basket