Recombinant Full Length Cyanidioschyzon Merolae Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL36351CF |
Product Overview : | Recombinant Full Length Cyanidioschyzon merolae ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (Q9TJ83) (1-603aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cyanidioschyzon merolae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-603) |
Form : | Lyophilized powder |
AA Sequence : | MKNLWIWSLPLIVLAFIGWQELANQMPVATSRMTYGRLLEYMQMGWVKRIDVYDRTALIE ASSPETGWQWIRVDLPANSSDWLEQAKTLHIDVDVHAVSNWINVASNWIIPLIIIGVVIW LLSRSASSNTTGALNFGKSKARFQMVAKTGIMFDDVAGIEEAKEELAEVVAFLKNPSKFL AVGASIPKGVLLVGPPGTGKTLLAKAIAGEASVPFFSISGSEFVEMFVGVGASRVRDLFK KAKQNAPCLVFIDEIDAVGRQRGAGIGGGNDEREQTLNQLLTEMDGFEGNTGVIVIAATN RVDVLDAALLRPGRFDRQIMVSMPDVKSRIAILKVHANQKKLHPQVSLEAVARRTAGFAG ADLANLLNEAAILAVRRGLKQITWKEIDDAIDRVIAGMEGTPIMDGKIKRLIAYHETGHA LTATLLPNHPPVQKVTLIPRRQAKGLTWFMQDNERDLLSKSQLMSMIMVALGGRAAEEAV FGNAEVTTGASNDLQQVTNLARQMVTRFGMSSLGPLCLETGNEEIFLGRDMRLMPEVSEE VIAQIDAQVRGMIEACYEKVLELMQANRVVMDRIVEELMEKETLDGKEFRQLVSQAARLT AVN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; ATP-dependent zinc metalloprotease FtsH; FtsHCP |
UniProt ID | Q9TJ83 |
◆ Recombinant Proteins | ||
ZMYM4-19202M | Recombinant Mouse ZMYM4 Protein | +Inquiry |
SUD-0024P2-2504S | Recombinant Staphylococcus aureus (strain: 18807) SUD_0024P2 protein, His-tagged | +Inquiry |
CAMKV-1110R | Recombinant Rat CAMKV Protein | +Inquiry |
Casc1-1722R | Recombinant Rat Casc1 protein, His & T7-tagged | +Inquiry |
HLCS-2244H | Recombinant Human HLCS Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
RPE-425 | Native Red algae RPE | +Inquiry |
Tf-264R | Native Rat Transferrin | +Inquiry |
C3-8092H | Native Human Plasma COMPLEMENT C (C3) | +Inquiry |
C4A-2H | Native Human Complement C4 | +Inquiry |
R-PE-004R | Native Red Fluorescent Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTA3-4092HCL | Recombinant Human MTA3 293 Cell Lysate | +Inquiry |
ATG5-8622HCL | Recombinant Human ATG5 293 Cell Lysate | +Inquiry |
UBL5-552HCL | Recombinant Human UBL5 293 Cell Lysate | +Inquiry |
CLPP-7434HCL | Recombinant Human CLPP 293 Cell Lysate | +Inquiry |
GYG2-768HCL | Recombinant Human GYG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket