Recombinant Full Length Cronobacter Sakazakii Probable Intracellular Septation Protein A (Esa_01553) Protein, His-Tagged
Cat.No. : | RFL25534CF |
Product Overview : | Recombinant Full Length Cronobacter sakazakii Probable intracellular septation protein A (ESA_01553) Protein (A7MMH0) (1-178aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cronobacter sakazakii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-178) |
Form : | Lyophilized powder |
AA Sequence : | MKQLLDFLPLIVFFVVYKLHDIFWATAALIVATALAVIYSWYKYRKVEKMTLVTFVLVAV FGGLTIYFHNAEFIKWKVTIIYALFAGALLIGQWVMKKPLIQSMLGKEITLPAHAWSRLN IAWALFFIFCGLLNIYVAFWLPEAVWMNFKVFGIPGLTLVFTLLSGVYIYRHMPQEEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ESA_01553 |
Synonyms | yciB; ESA_01553; Inner membrane-spanning protein YciB |
UniProt ID | A7MMH0 |
◆ Native Proteins | ||
CKMM-382H | Native Human Creatine Kinase MM (CK-MM) | +Inquiry |
LDH5-24H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
ApoC-II-3558H | Native Human ApoC-II | +Inquiry |
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
ADPGK-45 | Active Native ADP-specific glucokinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIF3B-931HCL | Recombinant Human KIF3B cell lysate | +Inquiry |
RCOR3-535HCL | Recombinant Human RCOR3 lysate | +Inquiry |
PTPMT1-1436HCL | Recombinant Human PTPMT1 cell lysate | +Inquiry |
PPAN-2993HCL | Recombinant Human PPAN 293 Cell Lysate | +Inquiry |
FANCF-6332HCL | Recombinant Human FANCF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ESA_01553 Products
Required fields are marked with *
My Review for All ESA_01553 Products
Required fields are marked with *
0
Inquiry Basket