Recombinant Full Length Coxiella Burnetii Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL21279CF |
Product Overview : | Recombinant Full Length Coxiella burnetii Membrane protein insertase YidC(yidC) Protein (B6J2B4) (1-566aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Coxiella Burnetii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-566) |
Form : | Lyophilized powder |
AA Sequence : | MDIKRIILYVIVALLAIALFNAWQRDYPPTPKPTPTVEQPTANGDHPTAYTPPAFTPGAA EKTKKAGTIALTSKVSEARLITVRTDVLDVEIDTQGGNIVSAKLPKYPVSLEEKQTPVQI LSGEPNELYVAQSGLTNGNGQPTTVQFESEKKQYVLENGQNQLIVQLTGRAPDGLLVTKT YTFHRDDYAIHLAYQVKNNTSKPWQGSLYTQITRRQPPTEHHHFYVRSYNGASMGSPQTP YEKLSYESLDKQNIDRTSQSGWIAMQQHYFLSAWVPGNPELTYHYYSHVIPASDEPNVYV VGFVSPQMNVAAGSEAATHATLYVGPEIAKRLKGLAPGLERTIDYGWLWPISMLLFWILS AVHAVFKNWGWSIIITTILIKIVFYWFSAKSFRSMARMREMQPRIQALKERHGDDRQALS RATMELYRKEKINPLGGCLPMLIQVPVFIAFYYVIIESVQLRQAPFIFWIHDLSVKDPYY ILPIIMGLSMLAQQWLSPTSPDPTQQKMMWILPVIFTVFFINFPAGLVLYWITNNVVQTL QQWYVNKTYESHKAKLKARRARKRKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; CbuG_0029; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | B6J2B4 |
◆ Recombinant Proteins | ||
SLC36A2-8346M | Recombinant Mouse SLC36A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LST1-2408R | Recombinant Rhesus Macaque LST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ndufs2-4345M | Recombinant Mouse Ndufs2 Protein, Myc/DDK-tagged | +Inquiry |
NUF2-30416TH | Recombinant Human NUF2, His-tagged | +Inquiry |
GTF2E2-8456H | Active Recombinant Human GTF2E2, His-tagged | +Inquiry |
◆ Native Proteins | ||
A2M-01H | Native Human A2M Protein | +Inquiry |
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
pepsin -174P | Native Pig pepsin(1:3000) active | +Inquiry |
LRP1-87H | Native Human Lipoproteins | +Inquiry |
CA2-34R | Native Rabbit Carbonic Anhydrase II (CA2) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PKM2-3152HCL | Recombinant Human PKM2 293 Cell Lysate | +Inquiry |
C2CD2L-1791HCL | Recombinant Human C2CD2L cell lysate | +Inquiry |
YBX2-1946HCL | Recombinant Human YBX2 cell lysate | +Inquiry |
P815-01HCL | Human P815 lysate | +Inquiry |
PDAP1-3364HCL | Recombinant Human PDAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket