Recombinant Full Length Escherichia Coli O157:H7 Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL1579EF |
Product Overview : | Recombinant Full Length Escherichia coli O157:H7 Membrane protein insertase YidC(yidC) Protein (B5YXA9) (1-548aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-548) |
Form : | Lyophilized powder |
AA Sequence : | MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKL ISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGP DNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNV QNAGEKPLEISTFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD NENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQT GAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPL GGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQK MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL HSREKKKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; ECH74115_5135; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | B5YXA9 |
◆ Recombinant Proteins | ||
M6PR-4378B | Recombinant Bovine M6PR Full Length Transmembrane protein, His-tagged | +Inquiry |
METTL26-942H | Recombinant Human METTL26 Protein, MYC/DDK-tagged | +Inquiry |
CCL26-0631H | Recombinant Human CCL26 Protein, GST-Tagged | +Inquiry |
BRD9-23H | Recombinant Human BRD9 Protein(130-259 aa), GST-tagged | +Inquiry |
RPSA-7800M | Recombinant Mouse RPSA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ACHE-8345H | Native Human ACHE | +Inquiry |
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
Lectin-1755C | Active Native Canavalia ensiformis Concanavalin A Protein | +Inquiry |
HPIV2ag-272V | Native Parainfluenza Virus type 2(strain II ALTB cc 2056) Protein | +Inquiry |
TF-8273H | Native Human Serum Transferrin HOLO(iron-saturated) | +Inquiry |
◆ Cell & Tissue Lysates | ||
PANC-1-058HCL | Human PANC-1 Cell Nuclear Extract | +Inquiry |
RDX-2433HCL | Recombinant Human RDX 293 Cell Lysate | +Inquiry |
Esophagus-1H | Human Esophagus Tumor Lysate | +Inquiry |
CMTM7-7415HCL | Recombinant Human CMTM7 293 Cell Lysate | +Inquiry |
DUOXA1-1197HCL | Recombinant Human DUOXA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket