Recombinant Full Length Cowpox Virus Hemagglutinin(Ha) Protein, His-Tagged
Cat.No. : | RFL8992CF |
Product Overview : | Recombinant Full Length Cowpox virus Hemagglutinin(HA) Protein (O72737) (17-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cowpox virus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (17-314) |
Form : | Lyophilized powder |
AA Sequence : | TPSPQTSKKIGDDATLSCNRNNTTDYVVMSAWYKEPNSIILLAAKSDVLYFDNYTKDKIS YDSPYDDLVTTITIKSLTARDAGTYVCAFFMTSTTNDTDKVDYEEYSTELIVNTDSESTI DIILSGSTHSPETSSEKPDYIDNSNCSSVFEIATPEPITDNEEDHTDVTYTSENINTVST TSRESTTDETPEPITDKEEDHTVTDTVSYTTVSTSSGIVTTKSTTDDADLYDTYNDNDTV PPTTVGGSTTSISNYKTKDFVEIFGITALIILSAVAIFCITYYICNKRSRKYKTENKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HA |
Synonyms | HA; A58R; Protein A56; Hemagglutinin |
UniProt ID | O72737 |
◆ Native Proteins | ||
HA-007R | Native Rooster comb Hyaluronic acid sodium salt | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-881HCL | Recombinant H7N9 HA cell lysate | +Inquiry |
HA-2326HCL | Recombinant H16N3 HA cell lysate | +Inquiry |
HA-2815HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
HA-748HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
HA-763HCL | Recombinant H7N9 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HA Products
Required fields are marked with *
My Review for All HA Products
Required fields are marked with *
0
Inquiry Basket