Recombinant Full Length Colwellia Psychrerythraea Lipid A Export Atp-Binding/Permease Protein Msba 1(Msba1) Protein, His-Tagged
Cat.No. : | RFL25589CF |
Product Overview : | Recombinant Full Length Colwellia psychrerythraea Lipid A export ATP-binding/permease protein MsbA 1(msbA1) Protein (Q483B6) (1-602aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Colwellia Psychrerythraea |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-602) |
Form : | Lyophilized powder |
AA Sequence : | MASSPKTNALSSSDSANATTWQNFKRLVSYAKPYKLGFVAAIIGMLGYAAIDVYFLSQLK PLVDEGLSGANANFMKWAPLFIIVAFTVRGIAHFIANYCLAWVGNNVVADLRQKLFEHIM SMPVAFHDQTSTGSLISKITFDTEQVLNSVSKSILTIVQQSAFIIGLLGLMFYYSWQLSL IFLLITPIIAVIVSVVSKRFRKVSKNIQGAMGEVTTAAEQTFNGHKVVLTFGGQQREFSR FAKINKHNRQQRMKMRATKSASVPIIQVIASFALAFVFYAITSDSLRDSISPGTFVSIIT YMTMLLRPLKMLTNVNSEFQQGMAACTSIFSILDHEKEKDNGDKQLERASGTLSFKHVDF SYKNTNTMTTSDKEQDTKLALNDITFDLAPGETLALVGRSGSGKSTASSLLLRFYDATRG EILIDDTNIEQFQLKDLRKQFSYVSQQVVLFNDTLANNIAYGKPEATEAEIIEAAKSAHV MEFAEHMEQGLETNIGENGALLSGGQRQRVAIARALLCDTPFLILDEATSALDTESERHI QDALQTLQQNRTSIVIAHRLSTIENADKIIVMEQGKIVEQGNHQSLLAKQGAYAQLHSFQ FE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA1 |
Synonyms | msbA1; CPS_2125; ATP-dependent lipid A-core flippase 1; Lipid A export ATP-binding/permease protein MsbA 1 |
UniProt ID | Q483B6 |
◆ Recombinant Proteins | ||
Rnf157-5549M | Recombinant Mouse Rnf157 Protein, Myc/DDK-tagged | +Inquiry |
GREM2-5324H | Recombinant Human GREM2 Protein, GST-tagged | +Inquiry |
KDR-0824H | Active Recombinant Human KDR protein, His-tagged | +Inquiry |
UNC45B-1933HFL | Recombinant Full Length Human UNC45B Protein, C-Flag-tagged | +Inquiry |
YQEK-3096B | Recombinant Bacillus subtilis YQEK protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LPA-8453H | Native Human LPA | +Inquiry |
F2-274B | Active Native Bovine α-Thrombin | +Inquiry |
ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
CLU-67H | Native Human Clusterin | +Inquiry |
Cry1Ab-523 | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRTC2-7271HCL | Recombinant Human CRTC2 293 Cell Lysate | +Inquiry |
MRPS18A-419HCL | Recombinant Human MRPS18A lysate | +Inquiry |
CMTM8-190HCL | Recombinant Human CMTM8 lysate | +Inquiry |
DYDC2-518HCL | Recombinant Human DYDC2 cell lysate | +Inquiry |
MAL2-4529HCL | Recombinant Human MAL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA1 Products
Required fields are marked with *
My Review for All msbA1 Products
Required fields are marked with *
0
Inquiry Basket