Recombinant Full Length Colletotrichum Graminicola Bifunctional Lycopene Cyclase/Phytoene Synthase (Glrg_02475) Protein, His-Tagged
Cat.No. : | RFL21290CF |
Product Overview : | Recombinant Full Length Colletotrichum graminicola Bifunctional lycopene cyclase/phytoene synthase (GLRG_02475) Protein (E3Q717) (1-587aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Colletotrichum graminicola |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-587) |
Form : | Lyophilized powder |
AA Sequence : | MGYDYALVHVKYTIPLAALLTVFSYPVFTRLDVVRTLFIVTIAFVATIPWDSYLIRTNVW TYPPDAVLGPTLYDIPAEELFFFIIQTYITAQLYIILNKPVLHAQYLNSPATLPQWIKSG KLVGQLALSGSVLLGTWLIAKKGEGTYLGLILVWACTFALFTWTITAHFLLALPLACTAL PILLPTVYLWIVDEMALGRGTWAIESGTKLELQLFGSLEIEEATFFLVTNMLIVFGIAAF DKAVAVCDAFPEKFDKPADALAMSLLRARVFPSSKYDMQRILGIRQAAARLAKKSRSFHL ASSVFPGRLRIDLTLLYSYCRLADDLVDDAATPEEAAVWISKLDRHLSLLYKDPDATSTP LASKYAAENFPPSALSALDMLPTSLLPREPLAELLKGFEMDLSFSNSAFPIADPEDLELY AARVASTVGQACLELVFCHCQHGLPDYMKAYLRNTARQMGLALQFVNISRDIAVDAKIGR VYLPTTWLKEEGLTPEDVLKSPNSEGVGKVRRRILAKALDHYGEARDSMKWIPSEARGPM IVAVESYMEIGRVLMRNGGSAAADGSGRATVPKSRRIWVAWSTLMAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GLRG_02475 |
Synonyms | GLRG_02475; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ] |
UniProt ID | E3Q717 |
◆ Recombinant Proteins | ||
CYP11A1-1372R | Recombinant Rat CYP11A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKR1C3-01H | Active Recombinant Human AKR1C3 Protein | +Inquiry |
ACOD1-3117H | Recombinant Human ACOD1 protein, His-tagged | +Inquiry |
RAG1-7400M | Recombinant Mouse RAG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFAIP3-4862R | Recombinant Rhesus monkey TNFAIP3 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Heparin-200S | Active Native Swine Heparin | +Inquiry |
Pla2-85A | Active Native Apis mellifera Phospholipase A2 | +Inquiry |
MBP-89S | Native Swine MBP Protein | +Inquiry |
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
GPT-188S | Active Native Swine Glutamate Pyruvate Transaminase | +Inquiry |
◆ Cell & Tissue Lysates | ||
HCAR3-737HCL | Recombinant Human HCAR3 cell lysate | +Inquiry |
IL32-2743HCL | Recombinant Human IL32 cell lysate | +Inquiry |
Apricot-681P | Apricot Lysate, Total Protein | +Inquiry |
ZNF296-2014HCL | Recombinant Human ZNF296 cell lysate | +Inquiry |
CALML5-7886HCL | Recombinant Human CALML5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLRG_02475 Products
Required fields are marked with *
My Review for All GLRG_02475 Products
Required fields are marked with *
0
Inquiry Basket