Active Recombinant Human AKR1C3 Protein

• Cat.No.: AKR1C3-01H
• Product Overview: Recombinant human AKR1C3 protein (1-323aa, 323aa) without tag was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 1-323
• Description: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding different isoforms have been found for this gene.
• Form: Liquid
• Bio-activity: Specific activity is > 1000 pmol/min/μg, and is defined as the amount of enzyme that catalyze the oxidation of 1.0 pmole 1-Acenaphthenol in the presence of NADP per minute at pH 8.8 at 25 centigrade.
• Molecular Mass: 36.8 kDa
• AA Sequence: MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: Enzyme Activity, SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.5) containing 0.1 M NaCl, 10% glycerol, 1 mM DTT

Gene Information

• Gene Name: AKR1C3 aldo-keto reductase family 1 member C3 [ Homo sapiens (human) ]
• Official Symbol: AKR1C3
• Synonyms: AKR1C3; aldo-keto reductase family 1 member C3; DD3; DDX; PGFS; HAKRB; HAKRe; HA1753; HSD17B5; hluPGFS; aldo-keto reductase family 1 member C3; 3-alpha hydroxysteroid dehydrogenase, type II; 3-alpha-HSD type II, brain; chlordecone reductase homolog HAKRb; dihydrodiol dehydrogenase 3; dihydrodiol dehydrogenase X; indanol dehydrogenase; prostaglandin F synthase; testosterone 17-beta-dehydrogenase 5; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; type IIb 3-alpha hydroxysteroid dehydrogenase; EC 1.1.1.188; EC 1.1.1.210; EC 1.1.1.239; EC 1.1.1.357; EC 1.1.1.53; EC 1.1.1.62; EC 1.1.1.64
• Gene ID: 8644
• mRNA Refseq: NM_003739
• Protein Refseq: NP_003730
• MIM: 603966
• UniProt ID: P42330