Recombinant Full Length Colicin V Secretion/Processing Atp-Binding Protein Cvab(Cvab) Protein, His-Tagged
Cat.No. : | RFL36175EF |
Product Overview : | Recombinant Full Length Colicin V secretion/processing ATP-binding protein CvaB(cvaB) Protein (P22520) (1-698aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-698) |
Form : | Lyophilized powder |
AA Sequence : | MTNRNFRQIINLLDLRWQRRVPVIHQTETAECGLACLAMICGHFGKNIDLIYLRRKFNLS ARGATLAGINGIAEQLGMATRALSLELDELRVLKTPCILHWDFSHFVVLVSVKRNRYVLH DPARGIRYISREEMSRYFTGVALEVWPGSEFQSETLQTRISLRSLINSIYGIKRTLAKIF CLSVVIEAINLLMPVGTQLVMDHAIPAGDRGLLTLISAALMFFILLKAATSTLRAWSSLV MSTLINVQWQSGLFDHLLRLPLAFFERRKLGDIQSRFDSLDTLRATFTTSVIGFIMDSIM VVGVCVMMLLYGGYLTWIVLCFTTIYIFIRLVTYGNYRQISEECLVREARAASYFMETLY GIATVKIQGMVGIRGAHWLNMKIDAINSGIKLTRMDLLFGGINTFVTACDQIVILWLGAG LVIDNQMTIGMFVAFSSFRGQFSERVASLTSFLLQLRIMSLHNERIADIALHEKEEKKPE IEIVADMGPISLETNGLSYRYDSQSAPIFSALSLSVAPGESVAITGASGAGKTTLMKVLC GLFEPDSGRVLINGIDIRQIGINNYHRMIACVMQDDRLFSGSIRENICGFAEEMDEEWMV ECARASHIHDVIMNMPMGYETLIGELGEGLSGGQKQRIFIARALYRKPGILFMDEATSAL DSESEHFVNVAIKNMNITRVIIAHRETTLRTVDRVISI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cvaB |
Synonyms | cvaB; Colicin V secretion/processing ATP-binding protein CvaB |
UniProt ID | P22520 |
◆ Recombinant Proteins | ||
TMIGD1-5669Z | Recombinant Zebrafish TMIGD1 | +Inquiry |
Pdgfra-52RAF488 | Recombinant Rat Pdgfra Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Snap29-5993M | Recombinant Mouse Snap29 Protein, Myc/DDK-tagged | +Inquiry |
RFL7091MF | Recombinant Full Length Mouse Lipoma Hmgic Fusion Partner-Like 1 Protein(Lhfpl1) Protein, His-Tagged | +Inquiry |
CD59-6830P | Recombinant Pig CD59 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
NADS-33 | Active Native NAD synthase | +Inquiry |
MMP11-27648TH | Native Human MMP11 | +Inquiry |
MPOA-233H | Native Human Myeloperoxidase Isoform A | +Inquiry |
a-Macroglobulin-535H | Active Native Human a-Macroglobulin | +Inquiry |
MB-238E | Native Horse Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPPA3-6826HCL | Recombinant Human DPPA3 293 Cell Lysate | +Inquiry |
C3P1-1010HCL | Recombinant Human C3P1 cell lysate | +Inquiry |
RELA-2423HCL | Recombinant Human RELA 293 Cell Lysate | +Inquiry |
PPIH-2969HCL | Recombinant Human PPIH 293 Cell Lysate | +Inquiry |
ZNF180-132HCL | Recombinant Human ZNF180 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cvaB Products
Required fields are marked with *
My Review for All cvaB Products
Required fields are marked with *
0
Inquiry Basket