Recombinant Full Length Coffea Arabica Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic Protein, His-Tagged
Cat.No. : | RFL26685CF |
Product Overview : | Recombinant Full Length Coffea arabica NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic Protein (A0A390) (1-363aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Coffea arabica (Arabian coffee) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-363) |
Form : | Lyophilized powder |
AA Sequence : | MIIDTTELQAINSFFKLESLKEVYGIIWILIPIFTLVLGITIGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQALADGTKLLFKENLLPSRGDARLFSIGPSIAVISILLSYSVIPFGY RLVLADLTIGVFLWIAISSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL SISLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFIIFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWNLSIPYIFVSEIFDINKAGKV FGPVIGIFITLAKTYLFLFIPIATRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSSQL LSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | A0A390 |
◆ Recombinant Proteins | ||
RFL1070HF | Recombinant Full Length Human Inward Rectifier Potassium Channel 2(Kcnj2) Protein, His-Tagged | +Inquiry |
IL2RA-2698R | Recombinant Rat IL2RA Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A19-1006H | Recombinant Human SLC25A19 Full Length Transmembrane protein, His-tagged | +Inquiry |
ASGR2-7375H | Recombinant Human ASGR2 protein, His-tagged | +Inquiry |
CLEC7A-0623H | Recombinant Human CLEC7A Protein (T66-M247), Flag tagged | +Inquiry |
◆ Native Proteins | ||
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
IgG-335G | Native GOAT Gamma Globulin Fraction | +Inquiry |
BCC-162B | Native Bovine Cholesterol Concentrate | +Inquiry |
Lectin-1852U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 649 labeled | +Inquiry |
Lectin-1861W | Active Native Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYO1D-1159HCL | Recombinant Human MYO1D cell lysate | +Inquiry |
LDLRAD2-4785HCL | Recombinant Human LDLRAD2 293 Cell Lysate | +Inquiry |
LMBR1L-4717HCL | Recombinant Human LMBR1L 293 Cell Lysate | +Inquiry |
SCARB2-2413MCL | Recombinant Mouse SCARB2 cell lysate | +Inquiry |
NDUFB4-3905HCL | Recombinant Human NDUFB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket