Recombinant Full Length Cocksfoot Mottle Virus Replicase Polyprotein P2Ab(Orf2A-2B) Protein, His-Tagged
Cat.No. : | RFL15206CF |
Product Overview : | Recombinant Full Length Cocksfoot mottle virus Replicase polyprotein P2AB(ORF2A-2B) Protein (Q0PW25) (398-942aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cocksfoot mottle virus (isolate Dactylis glomerata/Norway/CfMV-NO/1995) (CfMV) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (398-942) |
Form : | Lyophilized powder |
AA Sequence : | TAIRPLNLPAGGLPTGQSALGQLIEYAGYVWRDEGIINSNGMPFRSAGKSSCRFREAVCR AVHRDVRAAETEFPELKELAWPSRGSKAEIGSLLFQAGRFERVEAPANLQLAITNLQAQY PRSRPRSCFRREPWCREDFVAEIEKIAHSGEINLKASPGVPLAEIGVSNQQVIDVAWPLV CEAVVERLHALASVDPRQHDWSPEELVKRGLCDPVRLFVKQEPHSRQKIEQGRFRLISSV SLVDQLVERMLFGPQNTTEIALWHSNPSKPGMGLSKASQVALLWEDLARKHQTHPGAMAD ISGFDWSVQDWELWADVSMRIELGSFPALMAKAAISRFYCLMNATFQLTNGELLTQELPG LMKSGSYCTSSSNSRIRCLMAELIGSPWCIAMGDDSVEGWVDDAPRKYSALGHLCKEYEA CPVLPNGDLKEVSFCSHLISKGRAELETWPKCLFRYLSGPHDVESLEMELSSSRRWGQIV RYLRRIGRVSGNDGEERSSNESPATTKTQGSAAAWGPPQEAWPVDGASLSTFEPSSSGWF HLEGW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ORF2A-2B |
Synonyms | ORF2A-2B; Replicase polyprotein P2AB |
UniProt ID | Q0PW25 |
◆ Recombinant Proteins | ||
ATF1-1374H | Recombinant Human Activating Transcription Factor 1, His-tagged | +Inquiry |
Nde1-4320M | Recombinant Mouse Nde1 Protein, Myc/DDK-tagged | +Inquiry |
NEURL4-10597M | Recombinant Mouse NEURL4 Protein | +Inquiry |
MPXV-0786 | Recombinant Monkeypox Virus Protein, MPXVgp143 | +Inquiry |
ITIH4-669HFL | Recombinant Full Length Human ITIH4 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
PLAU -15H | Native Human HMW urokinase, HRP conjugate | +Inquiry |
HBB-001H | Native Human Hemoglobin S, Ferrous Stabilized | +Inquiry |
C3-08R | Native Rat C3 Protein | +Inquiry |
PKLR-244R | Active Native Rabbit Pyruvate Kinase | +Inquiry |
CAPN2-350B | Native Bovine CAPN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP8-001MCL | Recombinant Mouse MMP8 cell lysate | +Inquiry |
RSPH1-2131HCL | Recombinant Human RSPH1 293 Cell Lysate | +Inquiry |
ARPP19-8681HCL | Recombinant Human ARPP19 293 Cell Lysate | +Inquiry |
DYNLT1-6754HCL | Recombinant Human DYNLT1 293 Cell Lysate | +Inquiry |
GJA5-5920HCL | Recombinant Human GJA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ORF2A-2B Products
Required fields are marked with *
My Review for All ORF2A-2B Products
Required fields are marked with *
0
Inquiry Basket