Recombinant Full Length Coccidioides Posadasii Putative Dipeptidase Cpsg_01350 (Cpsg_01350) Protein, His-Tagged
Cat.No. : | RFL3159CF |
Product Overview : | Recombinant Full Length Coccidioides posadasii Putative dipeptidase CPSG_01350 (CPSG_01350) Protein (E9CV02) (1-461aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Coccidioides posadasii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-461) |
Form : | Lyophilized powder |
AA Sequence : | MSARDNEKGSARSQPSHAAASEIENVPRPSRQQSWTGTMIKVFIICACAGIVSKYIIPLD SIFKSVHIDPHDYATRANRILSTTPLIDGHNDLPYLIRLETKNKIYDHEKLPFRTGLLSH TDQIKIQEGKLGGQFWSVFVECATDPNAEIDDPTWAVRDTLEQIDVTKRLVQEYPDLLEY CESASCAKAAFKRGKVGSFLGIEGGHQIGNSLASLRQVYDLGVRYITVTHNCDNAFATAA STVAVGKPDLGLTDFGREFVKEMNRLGMLVDLSHVSHQTMRDILSVTKAPVMFSHSSSYA LSKHLRNVPDDVLNGVTKNGGVVMVTFVPSFLKVDDPASATIHDAVDHILHVAKVAGWDH VGIGSDFDGTADVPEGLENVSKYPRLIELLLERGVTDEQARKLIGENILRVWSNVEEIAE NIRALGEKPNEETWSGRKWTAAIDIPMPFMFKDSADKRKEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CPSG_01350 |
Synonyms | CPSG_01350; Putative dipeptidase CPSG_01350 |
UniProt ID | E9CV02 |
◆ Recombinant Proteins | ||
CAPNS1-1126R | Recombinant Rat CAPNS1 Protein | +Inquiry |
C1QC-586R | Recombinant Rhesus monkey C1QC Protein, His-tagged | +Inquiry |
Spike-429V | Recombinant COVID-19 Spike protein, mFc-tagged | +Inquiry |
SYK-109H | Recombinant Human SYK Protein, His-FLAG-tagged | +Inquiry |
YVAD-4080B | Recombinant Bacillus subtilis YVAD protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Immunoglobulin-5264B | Native Bovine Immunoglobulin Protein | +Inquiry |
PRSS7-42P | Native Porcine Enterokinase | +Inquiry |
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
F9-301R | Native Rat Factor IXa | +Inquiry |
Lectin-1865W | Active Native Succinylated Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP8-6202HCL | Recombinant Human FKBP8 293 Cell Lysate | +Inquiry |
MFSD1-406HCL | Recombinant Human MFSD1 lysate | +Inquiry |
EIF3H-6659HCL | Recombinant Human EIF3H 293 Cell Lysate | +Inquiry |
Kidney-265G | Guinea Pig Kidney Lysate | +Inquiry |
FAM175B-6404HCL | Recombinant Human FAM175B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CPSG_01350 Products
Required fields are marked with *
My Review for All CPSG_01350 Products
Required fields are marked with *
0
Inquiry Basket