Recombinant Full Length Clostridium Cellulolyticum Cobalt Transport Protein Cbim(Cbim) Protein, His-Tagged
Cat.No. : | RFL7314CF |
Product Overview : | Recombinant Full Length Clostridium cellulolyticum Cobalt transport protein CbiM(cbiM) Protein (B8I0P7) (30-248aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Clostridium cellulolyticum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (30-248) |
Form : | Lyophilized powder |
AA Sequence : | MHIMEGYLAPGWCISWGVMCMPFLVIGFFSIKKKIEVSSKNLTLLAMCGAFAFVLSALKM PSVTGSCSHPTGVGLGAVLFGPTAMSVIGAIILLFQAILLAHGGITTLGANVFSMAIVGP LVSFGVFKLSKRWGAKAGLAVFLAVFFGDLMTYVITSVELAMAYPDATGSFMVSLGKFIS IFGFTQVPLAVCEGLLTVVIYNVLAKYSAKELKALSAIY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cbiM |
Synonyms | cbiM; Ccel_1266; Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM |
UniProt ID | B8I0P7 |
◆ Recombinant Proteins | ||
APLNRA-4454Z | Recombinant Zebrafish APLNRA | +Inquiry |
ORM1-0581H | Recombinant Human ORM1 Protein (Gln19-Ser201), His-tagged | +Inquiry |
RNF222-3940R | Recombinant Rhesus monkey RNF222 Protein, His-tagged | +Inquiry |
TNF-0806H | Recombinant Human TNF protein, Fc-tagged | +Inquiry |
CCDC6-2869HF | Recombinant Full Length Human CCDC6 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-322H | Native Human Collagen IV | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
CTSB-1647H | Native Human Cathepsin B | +Inquiry |
MB-238E | Native Horse Myoglobin | +Inquiry |
CP-8075R | Native Rat Serum Ceruloplasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL34-2783MCL | Recombinant Mouse IL34 cell lysate | +Inquiry |
DOK4-6846HCL | Recombinant Human DOK4 293 Cell Lysate | +Inquiry |
DEPDC7-6972HCL | Recombinant Human DEPDC7 293 Cell Lysate | +Inquiry |
PASK-3423HCL | Recombinant Human PASK 293 Cell Lysate | +Inquiry |
SLC25A12-1783HCL | Recombinant Human SLC25A12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cbiM Products
Required fields are marked with *
My Review for All cbiM Products
Required fields are marked with *
0
Inquiry Basket