Recombinant Full Length Clostridium Acetobutylicum Probable Tryptophan Transport Protein(Trpp) Protein, His-Tagged
Cat.No. : | RFL29732CF |
Product Overview : | Recombinant Full Length Clostridium acetobutylicum Probable tryptophan transport protein(trpP) Protein (Q97D63) (1-171aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Clostridium Acetobutylicum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-171) |
Form : | Lyophilized powder |
AA Sequence : | MRMNLKKLIINSLFLAVGVVLNQITPPILFGMKPDFSLAMLFIIILLNDDYKTCISTGVV AGLLAAAVTTFPGGQLPNIIDRIVTTSLVFIALRPFKDKINDKIHMIITTIVGTIISGSV FLGSALIIVGLPASFKALFITVVLPATIINAIVGTIIFVAVKKSMRVVFRQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | trpP |
Synonyms | trpP; CA_C3617; Probable tryptophan transport protein |
UniProt ID | Q97D63 |
◆ Recombinant Proteins | ||
F17AA-2368E | Recombinant Escherichia coli F17AA Protein (22-180 aa), His-SUMO-tagged | +Inquiry |
CD96-151H | Recombinant Human CD96 Protein, His-tagged | +Inquiry |
Cytochrome-1583D | Recombinant Desulfovibrio vulgaris (strain Miyazaki F/DSM 19637) Cytochrome Protein (Met1-Gln474), N-His tagged | +Inquiry |
ARID3B-707M | Recombinant Mouse ARID3B Protein, His (Fc)-Avi-tagged | +Inquiry |
GLRB-2224R | Recombinant Rat GLRB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
GOT-186S | Active Native Porcine Glutamate Oxaloacetate Tranasminase | +Inquiry |
Mb-160M | Native Mouse Mb | +Inquiry |
F12-13H | Native Human Factor beta-XIIa, Biotin Labeled | +Inquiry |
Artery-015H | Human Artery Lysate, Total Protein | +Inquiry |
Lectin-1728L | Active Native Lycopersicon Esculentum Lectin Protein, Texas Red conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDCA4-7643HCL | Recombinant Human CDCA4 293 Cell Lysate | +Inquiry |
TMEM92-924HCL | Recombinant Human TMEM92 293 Cell Lysate | +Inquiry |
MAN2B1-4524HCL | Recombinant Human MAN2B1 293 Cell Lysate | +Inquiry |
Skin-849P | Pig Skin Membrane Lysate, Total Protein | +Inquiry |
GSS-5720HCL | Recombinant Human GSS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All trpP Products
Required fields are marked with *
My Review for All trpP Products
Required fields are marked with *
0
Inquiry Basket