Recombinant Full Length Citrobacter Koseri Thiol:Disulfide Interchange Protein Dsbd(Dsbd) Protein, His-Tagged
Cat.No. : | RFL10091CF |
Product Overview : | Recombinant Full Length Citrobacter koseri Thiol:disulfide interchange protein DsbD(dsbD) Protein (A8AMR4) (20-569aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Citrobacter koseri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-569) |
Form : | Lyophilized powder |
AA Sequence : | GLFDAPGRSQFVPADQAFSFDFQQNQHDLNLSWQVKDGYYLYRKQISITPSQAEIAEVRL PAGVWHEDEFYGKSEIYRKRLNIPLIVNQAASGATLTVTYQGCADAGFCYPPETKTVPLS EVSASTVAKSTPSPVAAQTEETPQPAARLPFSALWALLIGIGIAFTPCVLPMYPLISGIV LGGKQRLSTGRALLLTFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLALVFTL LALSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILL YIAQSGNMWLGGGTLYLYALGMGLPLILITVFGNRLLPKSGPWMEHVKTAFGFVILALPV FLLERVIGDEWGLRLWSLLGVAFFGWAFITSLHARRSGMRIVQIILLAAALVSVRPLQDW AFGATTAQTQAHLNFKPITTVDALNQALAEAKGKPIMLDLYADWCVACKEFEKYTFSDPQ VQQTLGDTVLLQANVTANNAQDVALLRHLNVLGLPTILFFDAQGHEHPNARVTGFMDATT FSAHLRDRQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dsbD |
Synonyms | dsbD; CKO_03700; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase |
UniProt ID | A8AMR4 |
◆ Native Proteins | ||
MB-238E | Native Horse Myoglobin | +Inquiry |
Factor 4-88H | Native Human Platelet Factor 4 | +Inquiry |
Lectin-1863W | Active Native Wheat Germ Agglutinin Protein | +Inquiry |
Interferon alfa-P031H | Native Human interferon alpha therapeutic protein (Interferon alfa-n1) | +Inquiry |
Thrombin-12S | Native Atlantic salmon Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCTD10-5011HCL | Recombinant Human KCTD10 293 Cell Lysate | +Inquiry |
ZEB1-190HCL | Recombinant Human ZEB1 293 Cell Lysate | +Inquiry |
OGG1-1246HCL | Recombinant Human OGG1 cell lysate | +Inquiry |
BAAT-8533HCL | Recombinant Human BAAT 293 Cell Lysate | +Inquiry |
FAM171B-001HCL | Recombinant Human FAM171B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dsbD Products
Required fields are marked with *
My Review for All dsbD Products
Required fields are marked with *
0
Inquiry Basket