Recombinant Full Length Chondrus Crispus Atp Synthase Subunit A(Atp6) Protein, His-Tagged
Cat.No. : | RFL12274CF |
Product Overview : | Recombinant Full Length Chondrus crispus ATP synthase subunit a(ATP6) Protein (P48878) (1-253aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chondrus crispus (Carrageen Irish moss) (Polymorpha crispa) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-253) |
Form : | Lyophilized powder |
AA Sequence : | MQTHFIITSPLEQFEIVTIFPFSISGLNFSLTNSSLFLIIAVFLLLFWTSLSFYSNTLIP NNWQLVKESIYEITASMVQDNLGSKGEFYFPFIFTLHLLLLYCNLIGMIPYSFTVTSHIV FTFGLALSIFIGINLIGIQTHGFKFFALFLPRGVPLAIVPLLITIEFLSYIVKVFTLSIR LFANMTSGHTLLKIIAGFAWTMLSAGGLLAIFHLIPLALLLALTGLELAIAGLQAYVFTL LTCIYLNDVLDMH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATP6 |
Synonyms | ATP6; ATP synthase subunit a; F-ATPase protein 6 |
UniProt ID | P48878 |
◆ Recombinant Proteins | ||
EPHB4-356H | Recombinant Human EPHB4 protein, His-tagged, Biotinylated | +Inquiry |
ARL15A-5833Z | Recombinant Zebrafish ARL15A | +Inquiry |
HENMT1-334C | Recombinant Cynomolgus Monkey HENMT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZDHHC13-10310M | Recombinant Mouse ZDHHC13 Protein, His (Fc)-Avi-tagged | +Inquiry |
PGP-12695M | Recombinant Mouse PGP Protein | +Inquiry |
◆ Native Proteins | ||
TF-132B | Native Bovine Transferrin | +Inquiry |
CAT-1847B | Active Native Bovine, Catalase | +Inquiry |
Complement C4a-52H | Native Human Complement C4a | +Inquiry |
ALB-293B | Native Bovine ALB Protein, TRITC-labeled | +Inquiry |
HPIV1ag-276V | Native Parainfluenza Virus type 1(strain Sendai) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRF1-2873HCL | Recombinant Human PRF1 293 Cell Lysate | +Inquiry |
PLA2G4D-1368HCL | Recombinant Human PLA2G4D cell lysate | +Inquiry |
ARRDC1-8678HCL | Recombinant Human ARRDC1 293 Cell Lysate | +Inquiry |
SCHIP1-2034HCL | Recombinant Human SCHIP1 293 Cell Lysate | +Inquiry |
PTPRF-1439HCL | Recombinant Human PTPRF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ATP6 Products
Required fields are marked with *
My Review for All ATP6 Products
Required fields are marked with *
0
Inquiry Basket