Recombinant Full Length Chlorophyll A/B Light-Harvesting Protein Pcbc(Pcbc) Protein, His-Tagged
Cat.No. : | RFL35222PF |
Product Overview : | Recombinant Full Length Chlorophyll a/b light-harvesting protein pcbC(pcbC) Protein (P95505) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Prochlorothrix hollandica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MEECSCDNRFRRGNNEPAGFSLDEQWWAGNIRLVDLSGQLLGAHIAHAGLIAFWAGSITV LEVARYVPDVPFYEQGLGLLPHLATLGFGIGPDGTVVDTYPYFVIGILHLVTSAVLGAGG LFHTFKGPAILAEGGALAPKFHYDWGDTKQLSLILGHHLLLLGILCLAFVAKAMFWGGVY DASLGTVHTVSPNLNPADIFGYVFGFNHGQFNGLGMSSVDNLPDIIGGHVYIGILELIGG TWHILTKPFAIGAKPFSFSGEAILSYSLGAVGWMGLLSGFFVRYCDAAYPPQFYGPERSG AAAVQYILGVLLLVGHVWHATRARAGGEPVPYTPPAPQRGRFGMTRVAPAPARTFIGRGK PQPEPPKKKGLFGRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pcbC |
Synonyms | pcbC; Chlorophyll a/b light-harvesting protein PcbC |
UniProt ID | P95505 |
◆ Recombinant Proteins | ||
HEPACAM2-8071Z | Recombinant Zebrafish HEPACAM2 | +Inquiry |
EFCAB1-1387R | Recombinant Rhesus monkey EFCAB1 Protein, His-tagged | +Inquiry |
WZS2-3792W | Recombinant Wheat WZS2 protein, His-SUMO-tagged | +Inquiry |
FLT1-1314H | Recombinant Human FLT1 Protein (P801-L1158), His tagged | +Inquiry |
SDPRA-8287Z | Recombinant Zebrafish SDPRA | +Inquiry |
◆ Native Proteins | ||
Lectin-1869W | Active Native Wisteria Floribunda Lectin Protein, Biotinylated | +Inquiry |
C. albicans-38 | Native Candida albicans Antigen | +Inquiry |
LDL-242H | Native Human Lipoproteins, High Density | +Inquiry |
COD-39 | Active Native Choline oxidase | +Inquiry |
FGB-31B | Native Bovine Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSP-005BCL | Borrelia afzelii Cell Lysate | +Inquiry |
IYD-885HCL | Recombinant Human IYD cell lysate | +Inquiry |
MIPOL1-4309HCL | Recombinant Human MIPOL1 293 Cell Lysate | +Inquiry |
KLC4-938HCL | Recombinant Human KLC4 cell lysate | +Inquiry |
NHLT-01HL | Human Non-Hodgkins Lymphoma Tumor lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All pcbC Products
Required fields are marked with *
My Review for All pcbC Products
Required fields are marked with *
0
Inquiry Basket