Recombinant Full Length Chlorophyll A/B Light-Harvesting Protein Pcb(Pcb) Protein, His-Tagged
Cat.No. : | RFL19884FF |
Product Overview : | Recombinant Full Length Chlorophyll a/b light-harvesting protein pcb(pcb) Protein (Q9F487) (1-324aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Fischerella muscicola |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-324) |
Form : | Lyophilized powder |
AA Sequence : | MAISTDKTFAANTNSPWLIGNARLIDLSGQLLGAHIAHAGLIMFWAGSITISEVTRFVPG IPMYEQQMTLLPHLATLGWGVGAGGEVINTYPYFVIGILHLVASAVLGAGGLFHVFRSPA ILYNSGGQVAKFHYEWNDPKKLGLILGHHLIILGFGAFLLVLKAMFFGGIYDTHIENVRL ITNPTFDPMTIFSYLVGIKDSHWTLLGIASVDNLEDVIGGHIWIGSILILGGIWHILVPP FAWVRQILPIVNGEEILSYSLLGLALMAFISAVFVGYNDTVFPKEFYGENRIVIATIQWV LGILALVGYFWHSWRSRELNSNLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pcb |
Synonyms | pcb; pcbC; Chlorophyll a/b light-harvesting protein Pcb |
UniProt ID | Q9F487 |
◆ Recombinant Proteins | ||
THEMIS2-9187M | Recombinant Mouse THEMIS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
N-583S | Recombinant SARS-CoV-2 Nucleocapsid (M234L) Protein, His-tagged | +Inquiry |
PDE4C-1600H | Recombinant Human PDE4C, GST-tagged | +Inquiry |
TAX1BP3-2158H | Recombinant Human TAX1BP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM173B-3013M | Recombinant Mouse FAM173B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen type I & III-185 | Native Porcine Collagen type I & III Protein | +Inquiry |
SERPINA3-8349H | Native Human SERPINA3 | +Inquiry |
ATP6AP2-27064TH | Native Human ATP6AP2 | +Inquiry |
COL1A1-26195TH | Native Human COL1A1 | +Inquiry |
APOA1-8034H | Native Human ApoLipoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
COA7-8173HCL | Recombinant Human C1orf163 293 Cell Lysate | +Inquiry |
HeLa-16H | HeLa Whole Cell Lysate, TNFa Stimulated | +Inquiry |
MCF2L-1068HCL | Recombinant Human MCF2L cell lysate | +Inquiry |
IMPDH1-5212HCL | Recombinant Human IMPDH1 293 Cell Lysate | +Inquiry |
GOLPH3L-5832HCL | Recombinant Human GOLPH3L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pcb Products
Required fields are marked with *
My Review for All pcb Products
Required fields are marked with *
0
Inquiry Basket