Recombinant Full Length Chlorophyll A/B Light-Harvesting Protein Pcb(Pcb) Protein, His-Tagged
Cat.No. : | RFL30249PF |
Product Overview : | Recombinant Full Length Chlorophyll a/b light-harvesting protein pcb(pcb) Protein (Q6Q972) (1-350aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Prochloron didemni |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-350) |
Form : | Lyophilized powder |
AA Sequence : | MGMQTYGNPDVEYGWWAGNSRLAGFSGKWLAAHVAQAALIVFWAGAICLFEVARYTADVP LGEQNLILIPHMASLGLGIGEGGQIVDTFPYFAVGVVHLVSSAVIGAGGLYHSLRGPAIL KEGPARAPKFDFDWGDGKRLGFILGHHLILLGLGALFLVLWAVFFGIYDPVIGEVRTVTS PTLNPFTIFGYQTHFVETNTLEDLIGGHVYVAIIEISGGLWHIFCPPFKWAQRLIIYSGE GLLAYALGGLAIMGFTAAVYCAFNTLAYPVEFYGPPLDFRFSFAPYFIDTADLPSGQYTA RAWLCNVHFFLAFFVLQGHLWHALRTLGFDFKRIPAALGSLSEDVVDAKA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pcb |
Synonyms | pcb; Chlorophyll a/b light-harvesting protein Pcb |
UniProt ID | Q6Q972 |
◆ Native Proteins | ||
Immunoglobulin A1-77H | Native Human Immunoglobulin A1 | +Inquiry |
Lectin-1778G | Active Native Galanthus Nivalis Lectin Protein, Fluorescein labeled | +Inquiry |
CST3-8100H | Native Human Cystatin C (Cystatin 3) | +Inquiry |
ctxB-01V | Native Vibrio cholerae ctxB Protein | +Inquiry |
Lectin-1870W | Active Native Wisteria Floribunda Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNG10-5857HCL | Recombinant Human GNG10 293 Cell Lysate | +Inquiry |
PLA2G4C-3140HCL | Recombinant Human PLA2G4C 293 Cell Lysate | +Inquiry |
POLR2M-5742HCL | Recombinant Human GRINL1A 293 Cell Lysate | +Inquiry |
CHRM1-7521HCL | Recombinant Human CHRM1 293 Cell Lysate | +Inquiry |
PALB2-3451HCL | Recombinant Human PALB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pcb Products
Required fields are marked with *
My Review for All pcb Products
Required fields are marked with *
0
Inquiry Basket