Recombinant Full Length Chlorocebus Aethiops D(2) Dopamine Receptor Protein, His-Tagged
Cat.No. : | RFL30264CF |
Product Overview : | Recombinant Full Length Chlorocebus aethiops D(2) dopamine receptor Protein (P52702) (1-443aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlorocebus Aethiops |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-443) |
Form : | Lyophilized powder |
AA Sequence : | MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSKIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNADQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRSHLRAPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKNHPKIAKIFEIQTMPNGKTRTSLKTMSR RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA VNPIIYTTFNIEFRKAFLKILHC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DRD2 |
Synonyms | DRD2; D(2 dopamine receptor; Dopamine D2 receptor |
UniProt ID | P52702 |
◆ Recombinant Proteins | ||
DRD2-1956R | Recombinant Rat DRD2 Protein | +Inquiry |
DRD2-4823M | Recombinant Mouse DRD2 Protein | +Inquiry |
DRD2-11H | Recombinant Human DRD2 | +Inquiry |
DRD2-2527M | Recombinant Mouse DRD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL30264CF | Recombinant Full Length Chlorocebus Aethiops D(2) Dopamine Receptor Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DRD2-6817HCL | Recombinant Human DRD2 293 Cell Lysate | +Inquiry |
DRD2-21HL | Recombinant Human DRD2 HEK293T cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DRD2 Products
Required fields are marked with *
My Review for All DRD2 Products
Required fields are marked with *
0
Inquiry Basket