Recombinant Full Length Chlorobium Tepidum Upf0761 Membrane Protein Ct1325(Ct1325) Protein, His-Tagged
Cat.No. : | RFL8667CF |
Product Overview : | Recombinant Full Length Chlorobium tepidum UPF0761 membrane protein CT1325(CT1325) Protein (Q8KCT5) (1-422aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlorobium tepidum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-422) |
Form : | Lyophilized powder |
AA Sequence : | MKENSKEERGRLHGMVWSSSAFFSFMWRHFVHDRVLMSAGSLAFQTLLSLVPLMAVTLSI LKVFPVFASLKQYIGDFLFQNFAPAQGSILKGYLWEFIDKTSSLSTVGGLFLIVIVLFLI STIDQTLNDIWEVQTPRRRLQGFTLYWTVLTLGPVFIGTSVLASSYVWYSVFAEGALLEM KARVLSYVPVLNSVIAFFLLYMLVPNRKVRFTHALAGGVLAAVLFELAKRWFTFYVSSFA TFEHIYGALSVVPMLFFWIYLEWVVVLTGAEFVFSLGYFRPAVCPAREFDPLQGVPEVVA VLRSVWRAQLSGSFMTGKKLLASENSGDRSKLGHVVDFLKQNGILHKTADGGLAISADLH AVTLYDLYTKLPRELFNGDGCVDEGPASREFEPLRAEVREALRSAMQTPLITLVNDSTEK DS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CT1325 |
Synonyms | CT1325; UPF0761 membrane protein CT1325 |
UniProt ID | Q8KCT5 |
◆ Recombinant Proteins | ||
RFL33983GF | Recombinant Full Length Geobacter Metallireducens Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged | +Inquiry |
GREM1-2215H | Recombinant Human GREM1 Protein, His-tagged | +Inquiry |
PRKCG-28940TH | Recombinant Human PRKCG | +Inquiry |
RFL21601DF | Recombinant Full Length Dictyostelium Discoideum Upf0136 Membrane Protein(Ddb_G0271790) Protein, His-Tagged | +Inquiry |
CD163-6755H | Recombinant Human CD163 protein, His-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
GALT-10 | Active Native Streptoverticillium mobaraense | +Inquiry |
LDH-227H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
Collagen Type I-02M | Native Mouse Collagen Type I (Atelocollagen) Protein | +Inquiry |
IgM-04T | Native Toxoplasma gondii IgM antigen, RH strain | +Inquiry |
Complement C4b-51H | Native Human Complement C4b | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP6-7834HCL | Recombinant Human CASP6 293 Cell Lysate | +Inquiry |
FAM38B-6381HCL | Recombinant Human FAM38B 293 Cell Lysate | +Inquiry |
PARVA-3426HCL | Recombinant Human PARVA 293 Cell Lysate | +Inquiry |
ANPEP-3090HCL | Recombinant Human ANPEP cell lysate | +Inquiry |
HA-005H5N1CL | Recombinant H5N1 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CT1325 Products
Required fields are marked with *
My Review for All CT1325 Products
Required fields are marked with *
0
Inquiry Basket