Recombinant Full Length Chlorobium Phaeobacteroides Upf0761 Membrane Protein Cphamn1_1013 (Cphamn1_1013) Protein, His-Tagged
Cat.No. : | RFL860CF |
Product Overview : | Recombinant Full Length Chlorobium phaeobacteroides UPF0761 membrane protein Cphamn1_1013 (Cphamn1_1013) Protein (B3EQ23) (1-427aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlorobium phaeobacteroides |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-427) |
Form : | Lyophilized powder |
AA Sequence : | MKASDTGSAGVLAGKLSALLSYLRSFLPFMWKNFMQDRVLLSAGSLAFQTLLSLIPLMAV VLSVLSVSPVFETFKRYVDDFLFQNFVPASGSMIREYFWEFIGNTATVPTVGGIFLLIIA LFLISTIDHTINQIWDVRAPRKILQGFTLYWTVLTLGPIIIGSGLVASSYVWYTVFTEGP FLELRTRILSYLPLVNSFLAFFLLYMLVPNHRVRFLHAVSGAFLATWLFELSKQWFSFYV KTFATFEHIYGALSVIPLLFFWIYLIWVVALSGAEFVYCLGAVRQEVKKERKEFSTLHGL WDVLAVMEQIWKGQQCGQYVRYKKHALSGKGIDAARVRSIVAVLKENRLIHVTEDGEFAL HCDIHEVTLFDLYSILPPEILVGSDAAVSGKRFEQLYELEAAVAACLRESLDKPLALYIK QEEGLPE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cphamn1_1013 |
Synonyms | Cphamn1_1013; UPF0761 membrane protein Cphamn1_1013 |
UniProt ID | B3EQ23 |
◆ Recombinant Proteins | ||
HHEX-4151M | Recombinant Mouse HHEX Protein, His (Fc)-Avi-tagged | +Inquiry |
Aqp7-3603R | Recombinant Rat Aqp7, His-tagged | +Inquiry |
RFL10179MF | Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase Rnf133(Rnf133) Protein, His-Tagged | +Inquiry |
YDBN-3891B | Recombinant Bacillus subtilis YDBN protein, His-tagged | +Inquiry |
GABRG1-4650H | Recombinant Human GABRG1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
COL2A1-1648H | Native Human COL2A1 Protein | +Inquiry |
H3N20799-215I | Native H3N2 (A/Panama/2007/99) H3N20799 protein | +Inquiry |
SAA-95H | Native Human Serum amyloid A | +Inquiry |
CA2-35R | Native Rhesus monkey Carbonic Anhydrase II (CA2) Protein | +Inquiry |
IGFBP1-612H | Native Human Insulin-like Growth Factor Binding Protein 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A3-2090HCL | Recombinant Human S100A3 293 Cell Lysate | +Inquiry |
SLC41A3-1714HCL | Recombinant Human SLC41A3 293 Cell Lysate | +Inquiry |
ADSL-8995HCL | Recombinant Human ADSL 293 Cell Lysate | +Inquiry |
C10orf62-71HCL | Recombinant Human C10orf62 lysate | +Inquiry |
WBP11-1920HCL | Recombinant Human WBP11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cphamn1_1013 Products
Required fields are marked with *
My Review for All Cphamn1_1013 Products
Required fields are marked with *
0
Inquiry Basket