Recombinant Full Length Chlamydia Trachomatis Serovar L2B Deubiquitinase And Deneddylase Dub1(Cdu1) Protein, His-Tagged
Cat.No. : | RFL21307CF |
Product Overview : | Recombinant Full Length Chlamydia trachomatis serovar L2b Deubiquitinase and deneddylase Dub1(cdu1) Protein (B0BAX9) (1-403aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlamydia trachomatis serovar L2b |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-403) |
Form : | Lyophilized powder |
AA Sequence : | MLSPTNSTSKTAPVPPRDSSKPVLISEEPRNQLLQKVARTALAVLLVVVTLGLILLFYSF SDLQSFPWCCQTHPSTKEQPTISIPVPLPSPPLAVPRPSTPPAPTPAISRPSTPSAPKPS TPPPLLPKAPKPVKTQENLFPLVPEQVFVEMYEDMARRRIIEALVPAWDSDIIFKCLCYF HTLYPGLIPLETFPPATIFNFKQKIISILEDKKAVLRGEPIKGSLPICCSKENYRRHLQG TTLLPMFMWYHPTPKTLADTMQTMKQLAIKGSVGASHWLLVIVDIQARRLVYFDSLYNYV MPPEDMKKDLQSLAQQLDQVYPARNGQKFSVKIAAKEVIQKDSGFSCGAWCCQFLYWYLR DPFTDALNDLPVDSVERHENLASFVQACEAAVQDLPELSWPEA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cdu1 |
Synonyms | cdu1; CTLon_0243; Deubiquitinase and deneddylase Dub1; ChlaDub1 |
UniProt ID | B0BAX9 |
◆ Native Proteins | ||
Spleen-006H | Human Spleen Lysate, Total Protein | +Inquiry |
F2-5286R | Native Rat Coagulation Factor II | +Inquiry |
UO-44 | Active Native Urate oxidase | +Inquiry |
Thrombin-20H | Active Native Pig Thrombin | +Inquiry |
Mucin-357 | Native Porcine Mucin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX31-7010HCL | Recombinant Human DDX31 293 Cell Lysate | +Inquiry |
AMN1-8879HCL | Recombinant Human AMN1 293 Cell Lysate | +Inquiry |
WNT3-296HCL | Recombinant Human WNT3 293 Cell Lysate | +Inquiry |
CSAG1-1615HCL | Recombinant Human CSAG1 cell lysate | +Inquiry |
Spleen-087RCL | Adult Rat Spleen Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cdu1 Products
Required fields are marked with *
My Review for All cdu1 Products
Required fields are marked with *
0
Inquiry Basket