Recombinant Full Length Chlamydia Trachomatis Serovar A Na(+)-Translocating Nadh-Quinone Reductase Subunit F(Nqrf) Protein, His-Tagged
Cat.No. : | RFL1951CF |
Product Overview : | Recombinant Full Length Chlamydia trachomatis serovar A Na(+)-translocating NADH-quinone reductase subunit F(nqrF) Protein (Q3KKV3) (1-431aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlamydia trachomatis serovar A |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-431) |
Form : | Lyophilized powder |
AA Sequence : | MTWLSGLYSIFVASAAFCSLGLILVAVILLSRKFLIKVHPCKLKINNDDSLTKTVDSGKT LLSSLLDSGIAIPSPCGGKAACKQCKVRITKNADEPLETDRSTFSKQQLEQGWRLSCQTK VQHDLCLEVEERYFNASSWEGTVVSNENVATFIKELVLSVDPSRPIPFKPGGYLQITVPP YKTNTSDWKQTMDPQYYSDWETFHLFDQVIDNLSLDTDSANKAYSLASYPAELPLIKFNV RIATPPFVDQAPDPTIPWGVCSSYIFSLKPGDKVMISGPYGESFMKEDNRPVIFLIGGAG SSFGRSHILDLLLNKHSDRELTLWYGARSLKENIYQEEYEKLEKEFPNFHYHLVLSQPLQ EDLDQGWDKNDPIKTNFLFKAFELRQLSHLPNPEDYLYYVCGPALHNSSILTLLDNYGIE RSSIVLDDFGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nqrF |
Synonyms | nqrF; CTA_0806; Na(+-translocating NADH-quinone reductase subunit F; Na(+-NQR subunit F; Na(+-translocating NQR subunit F; NQR complex subunit F; NQR-1 subunit F |
UniProt ID | Q3KKV3 |
◆ Recombinant Proteins | ||
NNAT-4013R | Recombinant Rat NNAT Protein | +Inquiry |
CD99-177H | Recombinant Human CD99 Protein, Fc-tagged | +Inquiry |
FAM162A-5516M | Recombinant Mouse FAM162A Protein | +Inquiry |
BMP10-2429M | Recombinant Mouse BMP10 Protein | +Inquiry |
TNFSF8-21H | Recombinant Human TNFSF8 Protein (K166A+I168A+K169A), His-tagged | +Inquiry |
◆ Native Proteins | ||
CKM-26522TH | Native Human CKM | +Inquiry |
IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
Collagen Type III-07H | Native Human Collagen Type III | +Inquiry |
Thrombin-30B | Active Native Bovine alpha-Thrombin-BFPRck, Biotin-tagged | +Inquiry |
Ferritin-026H | Native Human Ferritin Protein, holo form | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC85B-161HCL | Recombinant Human CCDC85B lysate | +Inquiry |
GEM-5961HCL | Recombinant Human GEM 293 Cell Lysate | +Inquiry |
MOLT-4-1128H | MOLT-4 (human acute lymphoblastic leukemia, T cell) whole cell lysate | +Inquiry |
ALDH4A1-001HCL | Recombinant Human ALDH4A1 cell lysate | +Inquiry |
PPP6R2-1560HCL | Recombinant Human PPP6R2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nqrF Products
Required fields are marked with *
My Review for All nqrF Products
Required fields are marked with *
0
Inquiry Basket