Recombinant Full Length Chicken Violet-Sensitive Opsin Protein, His-Tagged
Cat.No. : | RFL23519GF |
Product Overview : | Recombinant Full Length Chicken Violet-sensitive opsin Protein (P28684) (1-347aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-347) |
Form : | Lyophilized powder |
AA Sequence : | MSSDDDFYLFTNGSVPGPWDGPQYHIAPPWAFYLQTAFMGIVFAVGTPLNAVVLWVTVRY KRLRQPLNYILVNISASGFVSCVLSVFVVFVASARGYFVFGKRVCELEAFVGTHGGLVTG WSLAFLAFERYIVICKPFGNFRFSSRHALLVVVATWLIGVGVGLPPFFGWSRYMPEGLQC SCGPDWYTVGTKYRSEYYTWFLFIFCFIVPLSLIIFSYSQLLSALRAVAAQQQESATTQK AEREVSRMVVVMVGSFCLCYVPYAALAMYMVNNRDHGLDLRLVTIPAFFSKSACVYNPII YCFMNKQFRACIMETVCGKPLTDDSDASTSAQRTEVSSVSSSQVGPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Violet-sensitive opsin |
Synonyms | Violet-sensitive opsin; Violet cone opsin; Violet cone photoreceptor pigment |
UniProt ID | P28684 |
◆ Recombinant Proteins | ||
SE1039-RS13210-1356S | Recombinant Staphylococcus equorum (strain: KS1039) SE1039_RS13210 protein, His-tagged | +Inquiry |
Asmt-3062M | Recombinant Mouse Asmt, His-tagged | +Inquiry |
CD40-017H | Recombinant Human CD40 protein, hFc-tagged | +Inquiry |
IFNA1-633D | Recombinant Dog IFNA1 protein, His & GST-tagged | +Inquiry |
LGALS7-230H | Recombinant Active Human LGALS7 Protein, His-tagged(N-ter) | +Inquiry |
◆ Native Proteins | ||
H1F0-01B | Native Bovine H1F0 Protein | +Inquiry |
KRT19-169H | Native Human Cytokeratin 19 | +Inquiry |
CTRC-1209B | Native Bovine Chymotrypsin C (Caldecrin) | +Inquiry |
H3N2-01I | Active Native IAV H3N2 Protein | +Inquiry |
TSH-1312B | Active Native Bovine TSH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCBP1-3403HCL | Recombinant Human PCBP1 293 Cell Lysate | +Inquiry |
PLB1-1369HCL | Recombinant Human PLB1 cell lysate | +Inquiry |
WTAP-277HCL | Recombinant Human WTAP 293 Cell Lysate | +Inquiry |
CST5-3027HCL | Recombinant Human CST5 cell lysate | +Inquiry |
UNC5B-767RCL | Recombinant Rat UNC5B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Violet-sensitive opsin Products
Required fields are marked with *
My Review for All Violet-sensitive opsin Products
Required fields are marked with *
0
Inquiry Basket