Recombinant Active Human LGALS7 Protein, His-tagged(N-ter)

• Cat.No.: LGALS7-230H
• Product Overview: Recombinant Active Human LGALS7 Protein with His tag (N-ter) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19. [provided by RefSeq, Jul 2008]
• Form: Powder
• Bio-activity: Measured by its ability to agglutinate human red blood cells. The ED50 for this effect is < 2 μg/mL.
• AA Sequence: SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 7.4)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: LGALS7 lectin, galactoside-binding, soluble, 7 [ Homo sapiens ]
• Official Symbol: LGALS7
• Synonyms: LGALS7; lectin, galactoside-binding, soluble, 7; galectin-7; GAL7; galectin 7; LGALS7A; PIG1; TP53I1
• Gene ID: 3963
• mRNA Refseq: NM_002307
• Protein Refseq: NP_002298
• MIM: 600615
• UniProt ID: P47929