Recombinant Full Length Chicken Olfactory Receptor-Like Protein Cor6(Cor6) Protein, His-Tagged
Cat.No. : | RFL21237GF |
Product Overview : | Recombinant Full Length Chicken Olfactory receptor-like protein COR6(COR6) Protein (P37072) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MASGNCTTPTTFILSGLTDNPGLQMPLFMVFLAIYTITLLTNLGLIALISIDLQLQTPMY IFLQNLSFTDAVYSTVITPKMLATFLEETKTISYVGCILQYFSFVLLTVRECLLLAVMAY DRYAAICKPLLYPAIMTKAVCWRLVKGLYSLAFLNFLVHTSGLLKLSFCSSNVVNHFFCD NSPLFQISSSSTALNELLVFIFGSLFVMSSIITILISYVFIILTVVRIRSKERKYKAFST CTSHLMAVSLFHGTIVFMYFQPANNFSLDKDKIMSLFYTVVIPMLNPLIYSWRNKEVKDA LHRAIATAVLFH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COR6 |
Synonyms | COR6; Olfactory receptor-like protein COR6 |
UniProt ID | P37072 |
◆ Recombinant Proteins | ||
IFI44-3728H | Recombinant Human IFI44 protein, GST-tagged | +Inquiry |
PRKCG-13366M | Recombinant Mouse PRKCG Protein | +Inquiry |
mcjB-1402E | Recombinant Escherichia coli mcjB protein, His&Myc-tagged | +Inquiry |
GPATCH2-5140H | Recombinant Human GPATCH2 Protein, GST-tagged | +Inquiry |
RFL32530GF | Recombinant Full Length Geobacter Bemidjiensis Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
XOD-22B | Native Bovine XOD Protein | +Inquiry |
IgA-251G | Native Goat Immunoglobulin A | +Inquiry |
A1AGP-01P | Native Porcine A1AGP Protein | +Inquiry |
GPDH-119R | Active Native Rabbit Glycerol-3-phosphate Dehydrogenase | +Inquiry |
CTSL1-27406TH | Native Human CTSL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BROX-8152HCL | Recombinant Human C1orf58 293 Cell Lysate | +Inquiry |
RBKS-2485HCL | Recombinant Human RBKS 293 Cell Lysate | +Inquiry |
RBM39-2471HCL | Recombinant Human RBM39 293 Cell Lysate | +Inquiry |
SPI1-1683HCL | Recombinant Human SPI1 cell lysate | +Inquiry |
TBX10-1205HCL | Recombinant Human TBX10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COR6 Products
Required fields are marked with *
My Review for All COR6 Products
Required fields are marked with *
0
Inquiry Basket