Recombinant Full Length Chicken Olfactory Receptor-Like Protein Cor5(Cor5) Protein, His-Tagged
Cat.No. : | RFL1888GF |
Product Overview : | Recombinant Full Length Chicken Olfactory receptor-like protein COR5(COR5) Protein (P37071) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MALGNCTTPTTFILSGLTDNPRLQMPLFMVFLAIYTITLLANLGLIALISVDFHLQTPMY IFLQNLSFTDAAYSTVITPKMLATFLEERRTISYVGCILQYFSFVLLTSSECLLLAVMAY DRYVAICKPLLYPAIMTKAVCWRLVEGLYSLAFLNSLVHTSGLLKLSFCSSNVVNHFFCD NSPLFQISSSSTTLNELLVFIFGSWFAMSSIITTPISYVFIILTVVRIRSKDGKYKAFST CTSHLMAVSLFHGTVIFMYLRPVKLFSLDTDKIASLFYTVVIPMLNPLIYSWRNKEVKDA LRRVIATNVWIH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COR5 |
Synonyms | COR5; Olfactory receptor-like protein COR5 |
UniProt ID | P37071 |
◆ Recombinant Proteins | ||
SPOP-3506H | Recombinant Human SPOP, His-tagged | +Inquiry |
APOA1A-8751Z | Recombinant Zebrafish APOA1A | +Inquiry |
RFL27386BF | Recombinant Full Length Bacillus Subtilis Stage Ii Sporulation Protein B(Spoiib) Protein, His-Tagged | +Inquiry |
LRRIQ1-9306M | Recombinant Mouse LRRIQ1 Protein | +Inquiry |
RFL17057PF | Recombinant Full Length Psilotum Nudum Cytochrome B6(Petb) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1793A | Active Native Artocarpus integrifolia Jacalin Protein, Biotinylated | +Inquiry |
HSV-2ag-268V | Active Native HSV-2 Protein | +Inquiry |
C1R-96H | Active Native Human C1r Enzyme | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
Placenta-020H | Human Placenta Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACADL-4HCL | Recombinant Human ACADL lysate | +Inquiry |
HEPH-5586HCL | Recombinant Human HEPH 293 Cell Lysate | +Inquiry |
GLOD4-212HCL | Recombinant Human GLOD4 cell lysate | +Inquiry |
SYNE1-1319HCL | Recombinant Human SYNE1 293 Cell Lysate | +Inquiry |
CWC27-7174HCL | Recombinant Human CWC27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COR5 Products
Required fields are marked with *
My Review for All COR5 Products
Required fields are marked with *
0
Inquiry Basket