Recombinant Full Length Chicken Glycerol-3-Phosphate Acyltransferase 3(Agpat9) Protein, His-Tagged
Cat.No. : | RFL35154GF |
Product Overview : | Recombinant Full Length Chicken Glycerol-3-phosphate acyltransferase 3(AGPAT9) Protein (Q5ZLL8) (1-446aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-446) |
Form : | Lyophilized powder |
AA Sequence : | MEELGSLAVWLGAAWLSLVFALIVLPSALGVSLGISEAYMWVLVKTLEWATIRIEKGVKK PQPQMLKIPAANGIIERDETPMEKEIAGLHRMEFRFSDIFYFCRKGFEAIVEDEVTQRFS SEELVSWNLLTRTNVNFHYVSLRLTVVWVIGVIVRYCFLLPLRFTLAAIGITSMIVGTTV VGQLPNGSLKNYLSEVVHLTCSRILVRALSGTIHYHNKENKPQKGGICVANHTSPIDAII LTNDGCYAMVGQVHGGLMGVIQRATVKACPHVWFERSEIKDRHLVTKRLREHVADKNKLP ILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPQFGDAFWNSSKYNIVSYLLRIM TSWAIVCHVWYMPPMVRKEGEDAVQFANRVRSAIARQGGLTELPWDGGLKRAKVKDSFKE EQQKNYSKMLVRNGSQGNLPAGTESD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPAT3 |
Synonyms | GPAT3; AGPAT9; RCJMB04_5j9; Glycerol-3-phosphate acyltransferase 3; GPAT-3; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10; AGPAT 10; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9; 1-AGP acyltransferase 9; 1-AGPAT 9; Lysophosphatidic acid acyltr |
UniProt ID | Q5ZLL8 |
◆ Recombinant Proteins | ||
SLC30A1-674C | Recombinant Cynomolgus Monkey SLC30A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSPBAP1-3527H | Recombinant Human HSPBAP1, His-tagged | +Inquiry |
Ptprb-5244M | Recombinant Mouse Ptprb Protein, Myc/DDK-tagged | +Inquiry |
CCL25-054C | Active Recombinant Human CCL25 Protein (127 aa) | +Inquiry |
Shh-1856R | Recombinant Rat Shh protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGF1-26203TH | Native Human FGF1 | +Inquiry |
CGB-1856H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
IgA-242D | Native Dog Immunoglobulin A | +Inquiry |
Collagen-318B | Native Bovine Collagen Type IV | +Inquiry |
Lectin-1843S | Active Native Solanum Tuberosum Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PP2D1-114HCL | Recombinant Human PP2D1 lysate | +Inquiry |
MAK-1048HCL | Recombinant Human MAK cell lysate | +Inquiry |
CCDC88B-648HCL | Recombinant Human CCDC88B cell lysate | +Inquiry |
CARD18-832HCL | Recombinant Human CARD18 cell lysate | +Inquiry |
N6AMT2-3995HCL | Recombinant Human N6AMT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPAT3 Products
Required fields are marked with *
My Review for All GPAT3 Products
Required fields are marked with *
0
Inquiry Basket