Recombinant Full Length Chicken Cytochrome B-C1 Complex Subunit Rieske, Mitochondrial(Uqcrfs1) Protein, His-Tagged
Cat.No. : | RFL11389GF |
Product Overview : | Recombinant Full Length Chicken Cytochrome b-c1 complex subunit Rieske, mitochondrial(UQCRFS1) Protein (Q5ZLR5) (77-272aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chicken |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (77-272) |
Form : | Lyophilized powder |
AA Sequence : | VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFIS SLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDP QHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNL EVPTYQFVGDDLVVVG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UQCRFS1 |
Synonyms | UQCRFS1; RCJMB04_5b19; Cytochrome b-c1 complex subunit Rieske, mitochondrial; Complex III subunit 5; Cytochrome b-c1 complex subunit 5; Rieske iron-sulfur protein; RISP; Rieske protein UQCRFS1; Ubiquinol-cytochrome c reductase iron-sulfur subunit |
UniProt ID | Q5ZLR5 |
◆ Recombinant Proteins | ||
RFL12766SF | Recombinant Full Length Hylobates Syndactylus Cytochrome B-C1 Complex Subunit Rieske, Mitochondrial(Uqcrfs1) Protein, His-Tagged | +Inquiry |
UQCRFS1-106H | Recombinant Human UQCRFS1 protein, GST-tagged | +Inquiry |
UQCRFS1-6459R | Recombinant Rat UQCRFS1 Protein | +Inquiry |
UQCRFS1-1207H | Recombinant Human UQCRFS1 Protein (79-274 aa), GST-tagged | +Inquiry |
UQCRFS1-569HF | Recombinant Full Length Human UQCRFS1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UQCRFS1-725HCL | Recombinant Human UQCRFS1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UQCRFS1 Products
Required fields are marked with *
My Review for All UQCRFS1 Products
Required fields are marked with *
0
Inquiry Basket