Recombinant Full Length Cercopithecine Herpesvirus 1 Envelope Glycoprotein E(Ge) Protein, His-Tagged
Cat.No. : | RFL22074CF |
Product Overview : | Recombinant Full Length Cercopithecine herpesvirus 1 Envelope glycoprotein E(gE) Protein (P30816) (25-539aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cercopithecine herpesvirus 1 (CeHV-1) (Simian herpes B virus) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-539) |
Form : | Lyophilized powder |
AA Sequence : | AIETTWKHASAGDEVRLFALPAARPGAPPAKVVWELDPMAACGSLRPSWVSLRPPGQVLD TVVDAECVSEPVLLAAWYERRDGGSEVPAPFWGPDGAPPQRGNVTNGTLVLREARVGDSG MHVLSVFHPPNATAARHVVFLKVAPRRPEPAGGTPPPRDDEEGGTEEPATPAPPPHPHPI AEVAHVRGVTVSLRTQTAILFAPGDTVHTDVSVMPIAHDDDPYVMEVVWVRFDVPEECGE MRIYEPCLYHPQLPECRSPADAPCAASVWTERLAVRRYGPCSRGVPPPRCPSDAAMESRA GLGWYGHTVNLQLRDASEASGGLYVCVVYVNGHVHAWGHVVISTASRYRNAVVERSPPRY RPPPVEPTPSAQPTGPRPAAPRAARLVGVLGAAVGLAVAGLSVWACVTCRRARAWRAVKR RDLMAPTYIRLADDELYGDLSSYGDSDDSEYDSDSDRLPGTDPAPKRGSGFQILSGAKAD PWSAGARQHGHLITFRADDTSRYRDPSSPDPPHRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gE |
Synonyms | gE; US8; Envelope glycoprotein E; gE |
UniProt ID | P30816 |
◆ Recombinant Proteins | ||
HMGCL-11427Z | Recombinant Zebrafish HMGCL | +Inquiry |
NR3C1-4217H | Recombinant Human NR3C1 Protein (Gln529-Lys779), N-His tagged | +Inquiry |
RFL31068BF | Recombinant Full Length Bovine Myelin Protein P0(Mpz) Protein, His-Tagged | +Inquiry |
TWNK-1698H | Recombinant Human TWNK Protein (32-684 aa), His-tagged | +Inquiry |
RGS19-3691R | Recombinant Rhesus Macaque RGS19 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Thrombin-20H | Active Native Pig Thrombin | +Inquiry |
HB-40C | Native Cattle Hemoglobin (HB) Protein | +Inquiry |
MUC16-1H | Native Human MUC16 protein | +Inquiry |
F9-266B | Active Native Bovine Factor IX | +Inquiry |
TcdA-188C | Active Native Clostridium difficile Toxin A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAX1BP3-1235HCL | Recombinant Human TAX1BP3 293 Cell Lysate | +Inquiry |
C22orf28-8093HCL | Recombinant Human C22orf28 293 Cell Lysate | +Inquiry |
THOC1-1095HCL | Recombinant Human THOC1 293 Cell Lysate | +Inquiry |
XRRA1-737HCL | Recombinant Human XRRA1 lysate | +Inquiry |
TNFRSF14-001MCL | Recombinant Mouse TNFRSF14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All gE Products
Required fields are marked with *
My Review for All gE Products
Required fields are marked with *
0
Inquiry Basket