Recombinant Full Length Caulobacter Crescentus Upf0391 Membrane Protein Cc_0673(Cc_0673) Protein, His-Tagged
Cat.No. : | RFL33183CF |
Product Overview : | Recombinant Full Length Caulobacter crescentus UPF0391 membrane protein CC_0673(CC_0673) Protein (Q9AAC9) (1-60aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caulobacter crescentus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-60) |
Form : | Lyophilized powder |
AA Sequence : | MLKWAIILAIVALIAGALGFSGLAGAAAGVAKILFFLFLVGFVLVLLLGGTVFKAATGPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CC_0673 |
Synonyms | CC_0673; UPF0391 membrane protein CC_0673 |
UniProt ID | Q9AAC9 |
◆ Native Proteins | ||
TF-261M | Native Monkey Transferrin | +Inquiry |
Lectin-1800L | Active Native Lycopersicon Esculentum Lectin Protein, Agarose bound | +Inquiry |
IgG-218D | Native Dog Immunoglobulin G | +Inquiry |
APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
Lectin-1767D | Active Native Datura Stramonium Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYNC1LI1-6762HCL | Recombinant Human DYNC1LI1 293 Cell Lysate | +Inquiry |
NIPAL3-1207HCL | Recombinant Human NIPAL3 cell lysate | +Inquiry |
RHOG-542HCL | Recombinant Human RHOG lysate | +Inquiry |
CTBP1-7215HCL | Recombinant Human CTBP1 293 Cell Lysate | +Inquiry |
METTL25-8326HCL | Recombinant Human C12orf26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CC_0673 Products
Required fields are marked with *
My Review for All CC_0673 Products
Required fields are marked with *
0
Inquiry Basket