Recombinant Full Length Catostomus Commersonii Isotocin Receptor Protein, His-Tagged
Cat.No. : | RFL18538CF |
Product Overview : | Recombinant Full Length Catostomus commersonii Isotocin receptor Protein (Q90334) (1-390aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Catostomus commersonii (White sucker) (Cyprinus commersonnii) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-390) |
Form : | Lyophilized powder |
AA Sequence : | MEEMFKEQDFWSFNESSRNSTVGNETFGGNQTVNPLKRNEEVAKVEVTVLALVLFLALAG NLCVLIAIYTAKHTQSRMYYLMKHLSIADLVVAVFQVLPQLIWDITFRFYGPDFLCRLVK YLQTVGMFASTYMLVLMSIDRCIAICQPLRSLHKRKDRCYVIVSWALSLVFSVPQVYIFS LREIGNGVYDCWGDFVQPWGAKAYITWISLTIYIIPVAILGGCYGLISFKIWQNFKRKTK KDQCITLTTAASKANALARVSSVKLVSKAKITTVKMTFVIVLAYIVCWTPFFFVQMWSAW DPEAPREAMPFIISMLLASLNSCCNPWIYMFFAGHLFHDLKQSLLCCSTLYLKSSQCRCD QEHDSRKSNCSTYVIKSTSSQRSITQSSIT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Catostomus commersonii Isotocin receptor |
Synonyms | Isotocin receptor; ITR |
UniProt ID | Q90334 |
◆ Recombinant Proteins | ||
NUC-063 | OncoStat Panel | +Inquiry |
N-916V | Recombinant 2019-nCoV N(S202N) Protein, His-tagged | +Inquiry |
F-328H | Recombinant HRSV-B F Protein (Gln27-Asn524), C-hFc tagged, Animal-free, Carrier-free | +Inquiry |
Matk-3970M | Recombinant Mouse Matk Protein, Myc/DDK-tagged | +Inquiry |
IL4-138H | Active Recombinant Human IL4, His tagged | +Inquiry |
◆ Native Proteins | ||
PLG-15H | Native Human Plasminogen Protein | +Inquiry |
GPIIbIIIa-73H | Native Human GPIIbIIIa | +Inquiry |
Lectin-1761A | Active Native Agaricus bisporus lectin Protein, Fluorescein labeled | +Inquiry |
SERPINC1 -50P | Native Porcine Antithrombin III | +Inquiry |
LRP1-18H | Native Human Intermediate Density Lipoproteins Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC109B-149HCL | Recombinant Human CCDC109B lysate | +Inquiry |
ARL9-124HCL | Recombinant Human ARL9 cell lysate | +Inquiry |
WNT3-296HCL | Recombinant Human WNT3 293 Cell Lysate | +Inquiry |
RHOQ-2347HCL | Recombinant Human RHOQ 293 Cell Lysate | +Inquiry |
AMPH-8875HCL | Recombinant Human AMPH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Catostomus commersonii Isotocin receptor Products
Required fields are marked with *
My Review for All Catostomus commersonii Isotocin receptor Products
Required fields are marked with *
0
Inquiry Basket