Recombinant Full Length Catostomus Commersonii [Arg8]-Vasotocin Receptor Protein, His-Tagged
Cat.No. : | RFL6857CF |
Product Overview : | Recombinant Full Length Catostomus commersonii [Arg8]-vasotocin receptor Protein (Q90352) (1-434aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Catostomus commersonii (White sucker) (Cyprinus commersonnii) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-434) |
Form : | Lyophilized powder |
AA Sequence : | MGRIANQTTASNDTDPFGRNEEVAKMEITVLSVTFFVAVIGNLSVLLAMHNTKKKSSRMH LFIKHLSLADMVVAFFQVLPQLCWEITFRFYGPDFLCRIVKHLQVLGMFASTYMMVMMTL DRYIAICHPLKTLQQPTQRAYIMIGSTWLCSLLLSTPQYFIFSLSEIQNGSYVYDCWGHF IEPWGIRAYITWITVGIFLIPVIILMICYGFICHSIWKNIKCKTMRGTRNTKDGMIGKVS VSSVTIISRAKLRTVKMTLVIVLAYIVCWAPFFIVQMWSVWDENFSWDDSENAAVTLSAL LASLNSCCNPWIYMLFSGHLLYDFLRCFPCCKKPRNMLQKEDSDSSIRRNTLLTKLAAGR MTNDGFGSWRDPCNSRKSSQSIGLDCFCKSSQCLEHDCSRKSSQCIPLDCSRKSSQCIPL DCSRKSSQCMSKES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Catostomus commersonii [Arg8]-vasotocin receptor |
Synonyms | [Arg8]-vasotocin receptor; AVT |
UniProt ID | Q90352 |
◆ Recombinant Proteins | ||
SPTLC2B-6477Z | Recombinant Zebrafish SPTLC2B | +Inquiry |
RFL34580CF | Recombinant Full Length Campylobacter Curvus Upf0059 Membrane Protein Ccur92_01080 (Ccur92_01080) Protein, His-Tagged | +Inquiry |
CHAC2-3222H | Recombinant Human CHAC2 Protein, MYC/DDK-tagged | +Inquiry |
CLCN3-01H | Recombinant Human CLCN3 Protein, His-tagged | +Inquiry |
ANKRD37-594H | Recombinant Human ANKRD37 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-206M | Native Monkey Immunoglobulin G | +Inquiry |
SERPINA1-27286TH | Native Human SERPINA1 | +Inquiry |
Lectin-1833R | Active Native Ricinus Communis Agglutinin I Protein | +Inquiry |
ACT-161R | Native rabbit ACT | +Inquiry |
TPSAB1-02H | Active Native Human TPSAB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPY26P-1846HCL | Recombinant Human TSPY26P cell lysate | +Inquiry |
FAM45A-6377HCL | Recombinant Human FAM45A 293 Cell Lysate | +Inquiry |
DNASE1L1-6866HCL | Recombinant Human DNASE1L1 293 Cell Lysate | +Inquiry |
Bone-602R | Rat Bone Marrow Lysate, Total Protein | +Inquiry |
C10orf107-8376HCL | Recombinant Human C10orf107 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Catostomus commersonii [Arg8]-vasotocin receptor Products
Required fields are marked with *
My Review for All Catostomus commersonii [Arg8]-vasotocin receptor Products
Required fields are marked with *
0
Inquiry Basket