Recombinant Human ANKRD37 protein, GST-tagged

Cat.No. : ANKRD37-594H
Product Overview : Human ANKRD37 full-length ORF ( NP_859077.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ANKRD37 (Ankyrin Repeat Domain 37) is a Protein Coding gene. An important paralog of this gene is ANKRD10.
Molecular Mass : 43.3 kDa
AA Sequence : MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANKRD37 ankyrin repeat domain 37 [ Homo sapiens ]
Official Symbol ANKRD37
Synonyms ANKRD37; ankyrin repeat domain 37; ankyrin repeat domain-containing protein 37; Lrp2bp; hLrp2bp; low density lipoprotein receptor-related protein binding protein; low-density lipoprotein receptor-related protein 2-binding protein; MGC111507;
Gene ID 353322
mRNA Refseq NM_181726
Protein Refseq NP_859077
UniProt ID Q7Z713

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANKRD37 Products

Required fields are marked with *

My Review for All ANKRD37 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon