Recombinant Human ANKRD37 protein, GST-tagged

• Cat.No.: ANKRD37-594H
• Product Overview: Human ANKRD37 full-length ORF ( NP_859077.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ANKRD37 (Ankyrin Repeat Domain 37) is a Protein Coding gene. An important paralog of this gene is ANKRD10.
• Molecular Mass: 43.3 kDa
• AA Sequence: MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKRD37 ankyrin repeat domain 37 [ Homo sapiens ]
• Official Symbol: ANKRD37
• Synonyms: ANKRD37; ankyrin repeat domain 37; ankyrin repeat domain-containing protein 37; Lrp2bp; hLrp2bp; low density lipoprotein receptor-related protein binding protein; low-density lipoprotein receptor-related protein 2-binding protein; MGC111507
• Gene ID: 353322
• mRNA Refseq: NM_181726
• Protein Refseq: NP_859077
• UniProt ID: Q7Z713