Recombinant Full Length Cardiolipin Synthase 1(Cls1) Protein, His-Tagged
Cat.No. : | RFL17119BF |
Product Overview : | Recombinant Full Length Cardiolipin synthase 1(cls1) Protein (Q81V75) (1-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus anthracis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-509) |
Form : | Lyophilized powder |
AA Sequence : | MKKPIIQLLLIFTIVSIVPFLLNTSYISLYTFVGVLWSITIVGISFVIFIENRSPQSTLA WFLVLALLPVVGVLLYSIFGRSRWRRKKHLHRSEEQRKLFREILEGRRLELSLKVPLSER SVHLTEVVQKFGGGPAADRTTTKLLTNGDQTFSEILQAIEQAKHHIHIQYYIYKSDEIGT KVRDALIKKAKDGVIVRFLYDGLGSNTLRRRFLQPMKEAGIEIVEFDPIFSAWLLETVNY RNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLKVEGKALYKLQAIFLEDWLY ASSGLNTYSWDPFMNRQYFPGKEISNAEGAVQIVASGPSSDDKSIRNTLLAVMGSAKKSI WIATPYFIPDQETLTLLRLSAISGIDVRILYPGKSDSIISDQASQSYFTPLLKAGASIYS YKDGFMHAKILLVDDKIATIGTANMDVRSFELNYEIISVLYESETVHDIKRDFEDDFKHS TEIKWNAFQKRSIKKRILESFMRLISPLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls1 |
Synonyms | cls1; cls-1; BA_0625; GBAA_0625; BAS0592; Cardiolipin synthase 1; CL synthase 1 |
UniProt ID | Q81V75 |
◆ Recombinant Proteins | ||
ADAM9-1386Z | Recombinant Zebrafish ADAM9 | +Inquiry |
RFL17202SF | Recombinant Full Length Staphylococcus Aureus Uncharacterized Membrane Protein Sacol0809(Sacol0809) Protein, His-Tagged | +Inquiry |
GZMB-191H | Recombinant Human GZMB | +Inquiry |
EPO-1203P | Recombinant Pig EPO Protein, His-tagged | +Inquiry |
Ptdss1-5215M | Recombinant Mouse Ptdss1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
F2-5286R | Native Rat Coagulation Factor II | +Inquiry |
Thrombin-20H | Active Native Pig Thrombin | +Inquiry |
APOA1-26121TH | Native Human APOA1, Protein A-tagged | +Inquiry |
PAEP-04B | Native Bovine PAEP Protein | +Inquiry |
IgG-253R | Native Rabbit IgG Protein, Tag Free, Agarose Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPOR-2055HCL | Recombinant Human EPOR cell lysate | +Inquiry |
RAB23-2618HCL | Recombinant Human RAB23 293 Cell Lysate | +Inquiry |
PNP-3071HCL | Recombinant Human PNP 293 Cell Lysate | +Inquiry |
EPHB3-001HCL | Recombinant Human EPHB3 cell lysate | +Inquiry |
VMO1-402HCL | Recombinant Human VMO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cls1 Products
Required fields are marked with *
My Review for All cls1 Products
Required fields are marked with *
0
Inquiry Basket