Recombinant Full Length Capsule Polysaccharide Export Inner-Membrane Protein Kpse(Kpse) Protein, His-Tagged
Cat.No. : | RFL3830EF |
Product Overview : | Recombinant Full Length Capsule polysaccharide export inner-membrane protein kpsE(kpsE) Protein (P62587) (1-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-382) |
Form : | Lyophilized powder |
AA Sequence : | MLIKVKSAVSWMRARLSAISLADIQKHLAKIIILAPMAVLLIYLAIFSQPRYMSESKVAI KRSDDLNSGSLNFGLLLGASNPSSAEDALYLKEYINSPDMLAALDKQLNFREAFSHSGLD FLNHLSKDETAEGFLKYYKDRINVSYDDKTGLLNIQTQGFSPEFALKFNQTVLKESERFI NEMSHRIARDQLAFAETEMEKARQRLDASKAELLSYQDNNNVLDPQAQAQAASTLVNTLM GQKIQMEADLRNLLTYLREDAPQVVSARNAIQSLQAQIDEEKSKITAPQGDKLNRMAVDF EEIKSKVEFNTELYKLTLTSIEKTRVEAARKLKVLSVISSPQLPQESSFPNIPYLIACWL LVCCLLFGTLKLLLAVIEDHRD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kpsE |
Synonyms | kpsE; c3687; Capsule polysaccharide export inner-membrane protein KpsE |
UniProt ID | P62587 |
◆ Recombinant Proteins | ||
HSPA2-001H | Recombinant Human HSPA2 Protein, Myc/DDK-tagged | +Inquiry |
CYP3A39-133P | Active Recombinant Pig CYP3A39 Protein | +Inquiry |
BSG-3338H | Recombinant Human BSG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZWINT-19258M | Recombinant Mouse ZWINT Protein | +Inquiry |
Ppp1r15a-398R | Recombinant Rat Ppp1r15a Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
AC-63B | Native Bovine Activated Protein C | +Inquiry |
Ceruloplasmin-019B | Active Native Bovine Ceruloplasmin Protein | +Inquiry |
CAT-1646H | Native Human Catalase Protein | +Inquiry |
Tf-264R | Native Rat Transferrin | +Inquiry |
HBsAg-ad-21H | Native Human HBsAg protein (Subtype ad) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALLC-63HCL | Recombinant Human ALLC cell lysate | +Inquiry |
DLX2-6907HCL | Recombinant Human DLX2 293 Cell Lysate | +Inquiry |
C8orf48-133HCL | Recombinant Human C8orf48 lysate | +Inquiry |
ZNF480-2034HCL | Recombinant Human ZNF480 cell lysate | +Inquiry |
PIR-3169HCL | Recombinant Human PIR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All kpsE Products
Required fields are marked with *
My Review for All kpsE Products
Required fields are marked with *
0
Inquiry Basket