Recombinant Full Length Capsular Polysaccharide Type 8 Biosynthesis Protein Cap8A(Cap8A) Protein, His-Tagged
Cat.No. : | RFL24737SF |
Product Overview : | Recombinant Full Length Capsular polysaccharide type 8 biosynthesis protein cap8A(cap8A) Protein (P72367) (1-222aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-222) |
Form : | Lyophilized powder |
AA Sequence : | MESTLELTKIKEVLQKNLKILIILPLLFLIISAIVTFFVLSPKYQANTQILVNQTKGDNP QFMAQEVQSNIQLVNTYKEIVKSPRILDEVSKDLNNKYSPSKLSSMLTITNQENTQLINI QVKSGHKQDSEKIANSFAKVTSKQIPKIMSLDNVSILSKADGTAVKVAPKTVVNLIGAFF LGLVVALIYIFFKVIFDKRIKDEEDVEKELGLPVLGSIQKFN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cap8A |
Synonyms | cap8A; Capsular polysaccharide type 8 biosynthesis protein cap8A |
UniProt ID | P72367 |
◆ Recombinant Proteins | ||
NCKAP1-1176H | Recombinant Human NCKAP1, GST-tagged | +Inquiry |
KPNA6-301478H | Recombinant Human KPNA6 protein, GST-tagged | +Inquiry |
CASP8-6161C | Recombinant Chicken CASP8 | +Inquiry |
Fbln7-227M | Recombinant Mouse Fbln7 Protein, His-tagged | +Inquiry |
RFL35724HF | Recombinant Full Length Human Olfactory Receptor 4M2(Or4M2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
OX-LDL-985H | Native Human Lipoproteins, Oxidized LDL protein | +Inquiry |
ACTC1-885B | Native Bovine ACTC1 Protein, Pyrene labeled | +Inquiry |
CDA015 | Native Hepatitis B Surface Ag protein | +Inquiry |
Prethrombin-2-304R | Native Rat Prethrombin-2 | +Inquiry |
DES-167C | Native chicken DES | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC26A7-1751HCL | Recombinant Human SLC26A7 293 Cell Lysate | +Inquiry |
ACE2-887CCL | Recombinant Cynomolgus ACE2 cell lysate | +Inquiry |
APBB1IP-29HCL | Recombinant Human APBB1IP lysate | +Inquiry |
WNT2B-297HCL | Recombinant Human WNT2B 293 Cell Lysate | +Inquiry |
HA-2661HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cap8A Products
Required fields are marked with *
My Review for All cap8A Products
Required fields are marked with *
0
Inquiry Basket