Recombinant Full Length Capsicum Annuum Beta-Carotene Hydroxylase 2, Chloroplastic(Ca2) Protein, His-Tagged
Cat.No. : | RFL11115CF |
Product Overview : | Recombinant Full Length Capsicum annuum Beta-carotene hydroxylase 2, chloroplastic(CA2) Protein (O49814) (100-316aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Capsicum annuum (Bell pepper) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (100-316) |
Form : | Lyophilized powder |
AA Sequence : | AEKLARKKSERFTYLVAAVMSSFGITSMAVMAVYYRFYWQMEGGEVPFSEMFGTFALSVG AAVGMEFWARWAHKALWHASLWHMHESHHKPREGPFELNDVFAIINAVPAIALLDYGFFH KGLIPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPVANVPYLRKVAAAHSLHHSEKF NGVPYGLFLGPKELEEVGGLEELEKEVNRRTRYIKGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CA2 |
Synonyms | CA2; LOC107873401; T459_16578; Beta-carotene hydroxylase 2, chloroplastic |
UniProt ID | O49814 |
◆ Recombinant Proteins | ||
Car2-1191M | Recombinant Mouse Carbonic Anhydrase 2, His-tagged | +Inquiry |
Car2-765M | Recombinant Mouse Car2 Protein, MYC/DDK-tagged | +Inquiry |
CA2-1158M | Recombinant Mouse CA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CA2-2734HF | Recombinant Full Length Human CA2 Protein, GST-tagged | +Inquiry |
CA2-27265TH | Recombinant Human CA2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA2-7915HCL | Recombinant Human CA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CA2 Products
Required fields are marked with *
My Review for All CA2 Products
Required fields are marked with *
0
Inquiry Basket